KEGG   Pseudomonas mendocina ymp: Pmen_2294Help
Entry
Pmen_2294         CDS       T00510                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00500  Starch and sucrose metabolism
pmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pmen_2294
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Pmen_2294
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Pmen_2294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Soc
Motif
Other DBs
NCBI-ProteinID: ABP85052
UniProt: A4XUN6
LinkDB All DBs
Position
complement(2529406..2532708)
Genome map
AA seq 1100 aa AA seqDB search
MARRSSARTFLNDPQWYKDAVIYQVHVKSFFDANNDGIGDFQGLIDKLDYIADLGVNTLW
LLPFYPSPRRDDGYDIAMYRGVHPDYGSLTDARRFIAEAHRRGLRVITELVINHTSDQHP
WFQRARRAKKGSKARNYYVWSDHDDKYAGTRIIFIDSEKSNWTWDAVAGQYFWHRFYSHQ
PDLNFDNPRVIEAVLGVMRFWLDMGVDGLRLDAIPYLIERDGTSSENLPETHEVLKRIRA
EVDARYPDRMLLAEANQWPEDTRPYFGEDDECHMAFHFPLMPRMYMAIAQEDRFPITDIL
RQTPEIPPNCQWAIFLRNHDELTLEMVTDDERDYLWNYYAADSRARINLGIRRRLAPLVG
RDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSVDRNGGFSRAD
PASLVLPPIMDPLYGYQTINVEAQSRDPHSLLNWTRRMLAIRNQHKAFGRGSLEMLAPSN
RRILAYLRLHRTEEGSEECILCVANLSSAAQAVELELADYHDRVPVEMVGGASFPPIGQL
PYLLTLPPYGFYWFYLADASQMPSWHLKPVERMPELQTLVLSRGLSEVLEGRPRQILERE
SLPLYLPKRRWYAGDRIAAGAVRLLYVVPLDQEADAPLLAELEVRGEQGAEYYRLPLAAV
PERAEGNDLPQQMALARLRRGRHVELLTDAFSLPQFSQSILALLRQERVLHSAAGEIQFR
AEPALLALDSGEEATFKLLSAEQSNSSALVGNQILLKLLRRGFAGIHPEVEMSRFLGDQG
FANIAPLLGEVVRVDDQDQHTLVVVQGYLDNQGDAWLWTLNTLERAIREELTGGMSEPQV
DALAELAQFCSVLGKRVGEMHAVLARPTENPAFGCRLSDEQDCAAWRESIAEQLHQALRA
LQQQRDGLAPALAEQTDWLLAHEQQLQQALGHLTQRVAGGLRIRVHGDLHLGQVLVVQGD
AYVIDFEGEPNRTLQERRQYHSPFKDVAGMLRSIDYAAAVAQRSAGGMDGGGDSQQTVAA
LVARYREIARDAFLDGYRLAAAGLPHEWYERDGEEAALTLFSLEKAAYEIVYESGHRPDW
IDVPLQGLVDLARQLMEITS
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggccagacgcagcagcgccagaacctttctcaacgatccgcagtggtacaaggacgcg
gtgatctaccaggtccacgtgaagtccttcttcgatgccaacaacgacggcatcggcgac
ttccagggcctgatcgacaagctcgactacatcgccgacctcggggtgaacaccctctgg
ctgctgccgttctatccctcgccacggcgtgacgacggctacgacatcgccatgtaccgg
ggcgtgcacccggactacggcagcctcaccgacgcccgccgcttcatcgccgaggcgcac
cggcgcggcctgcgcgtgatcaccgagctggtgatcaaccacacctccgaccagcacccc
tggttccagcgcgcacggcgcgcgaagaagggctccaaggcgcgcaactactacgtctgg
tccgatcacgacgacaagtacgccggcacccggatcatcttcatcgacagcgagaagtcc
aactggacctgggacgcggtggccgggcagtacttctggcaccgcttctactcgcaccag
ccggacctcaacttcgacaacccgcgggtcatcgaggcggtgctcggggtgatgcgcttc
tggctcgacatgggcgtcgacggcctgcgcctggacgccatcccgtacttgatcgagcgc
gacggcaccagcagcgagaacctgccggaaacccacgaagtgctcaagcgcatccgcgcc
gaagtggatgcgcgctaccccgatcgcatgctgctggccgaggccaaccagtggccggag
gacacccgaccctacttcggcgaagacgacgaatgccacatggccttccacttcccgctg
atgccgcgcatgtacatggccatcgcccaggaagaccgttttcccatcaccgacatcctg
cgccagaccccggagattccgcccaattgccagtgggccatcttcctgcgcaaccacgat
gaactgaccctggagatggtcaccgacgacgagcgcgactacctgtggaactactacgcc
gccgacagtcgcgcgcgcatcaacctgggcatccgccggcgcctggcgcccctggtgggg
cgcgaccggcggcgcatcgagctgctcaacagcctgctgctgtcgatgcccggcacgccg
acgctgtactacggcgacgagatcggcatgggcgacaacatctacctgggcgaccgcgac
ggcgtgcgcacacccatgcagtggtcggtggaccgcaacggcgggttctcccgcgccgac
ccggccagcctggtgctgccgccgatcatggacccgctgtacggctaccagaccatcaac
gtcgaggcccagtcgcgcgacccgcactcgctgctcaactggacgcggcgcatgctcgcc
atccgcaaccagcacaaggccttcggccgcggcagcctggaaatgctggcaccgagcaac
cgacgcatcctcgcctacctgcgcctgcaccgcaccgaggagggcagcgaggaatgcatt
ctctgcgtggccaacctgtccagcgcggcccaggccgtcgaactggaactggccgactac
cacgaccgggtgccggtggagatggtcggcggcgcgtcctttccgcccatcggccagttg
ccctacctgctgaccctgccgccctacggtttctactggttctacctggccgacgcctcg
cagatgcccagctggcacctcaagccggtggaacgcatgcccgagctgcagaccctggtg
ctcagccgcggcctgagcgaagtgctggaaggccggccacggcagatcctcgagcgcgag
tcgctgccgctgtacctgccgaaacggcgctggtatgccggcgaccggatcgccgccggt
gcggttcgactgctctatgtcgtgccgctggaccaggaggccgacgcgcccctgctggcc
gaactggaggtgcgtggcgaacagggtgccgagtactaccgcctgccactggcggcggta
cccgagcgcgccgaaggcaacgacctgccgcagcagatggccctggccaggctgcgccgg
ggtcgccacgtggagctgctgaccgacgccttcagcctgccgcagttcagccagtcgatt
ctcgccctgctgcgtcaggagcgtgtgctgcacagcgccgcaggggagatccagttccgc
gccgagccggccctgctggccctggatagcggcgaggaggccaccttcaagctgctgtcg
gccgagcaatccaacagttcggcgctggtcggcaaccagatcctgctcaagctgctgcgc
cgcggtttcgccggcatccacccggaggtggaaatgagccgcttcctcggcgaccagggt
ttcgccaatatcgcgccgctgctgggcgaggtggtgcgggtcgacgaccaggaccagcac
accctggtcgtggtgcaaggctacctggacaaccagggcgacgcctggctgtggaccctc
aacaccctggaacgcgccattcgcgaagagctgaccggtggcatgagcgagccgcaggtc
gatgcgctggccgaactcgcgcagttctgcagcgtgctcggcaagcgcgtcggcgagatg
cacgcggtactggcgcggcccaccgagaatccggcgttcggctgtcgcctgagcgacgag
caggactgcgccgcctggcgcgagtcgatcgccgaacagctgcatcaggccctgcgcgcg
ctgcagcagcagcgcgacggcctggcgccggccctggccgaacagaccgactggctgctc
gcccacgaacagcagctgcagcaggcgctcggccatctcacccagcgtgtggccggcggt
ctgcgcatccgcgtgcatggcgacctgcacctgggccaggtgctggtggtgcagggcgat
gcctacgtcatcgacttcgagggcgagcccaatcgcaccctgcaggagcgccgccagtac
cacagcccgttcaaggacgtggccggcatgctgcgctcgattgattacgcagccgccgtg
gcccagcgcagcgccggaggcatggacggcggcggcgactcgcagcagacggtggcggcg
ctggtggcgcgctaccgcgaaattgcccgcgatgcctttctcgacggctaccgcctggcg
gcagccggcctgcctcacgaatggtacgaacgcgacggcgaagaggccgcgctgaccctg
ttcagcctggaaaaggccgcctacgaaatcgtctacgagagcgggcaccgccccgactgg
atcgacgttcccctgcagggcctggtggacctggcccgacaactgatggagataacgagt
tga

DBGET integrated database retrieval system