KEGG   Pseudomonas mendocina ymp: Pmen_2313Help
Entry
Pmen_2313         CDS       T00510                                 

Definition
(GenBank) protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy02025  Biofilm formation - Pseudomonas aeruginosa
pmy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pmen_2313
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Pmen_2313
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmy01001]
    Pmen_2313
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmy02044]
    Pmen_2313
Enzymes [BR:pmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Pmen_2313
Protein kinases [BR:pmy01001]
 Serine/threonine kinases: Other
  Bacterial family
   Pmen_2313
Secretion system [BR:pmy02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Pmen_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH VWA_2 Pkinase_fungal TssR VWA Kinase-like Kdo Phage_TTP_1
Motif
Other DBs
NCBI-ProteinID: ABP85071
UniProt: A4XUQ5
LinkDB All DBs
Position
complement(2549688..2552744)
Genome map
AA seq 1018 aa AA seqDB search
MDIEIPGYEIERELGDGAMAVVYLATQRSLERKVALKVMAAALAADPSFCERFLREGKTL
ARLSHPNTVTIHDIGNVGSHYYMAMEYLPNGTLKERIAAGLSAEQGIQYLRQIASALGYA
HAQGLVHRDVKPANILFRADGTAVLSDFGIAKSLEDRTQFTQAGFAVGTPSYMSPEQARG
QQVDGRTDLYALGVVLYEILTGQLPYVGADSLSTALAHLTQPLPELPIAQGRYQPILSRL
LAKDPADRFPDAAALIKALDELAASPVTAATGGDSEATQFRPLGLPDAPAQRSMPTDLGG
LQAVSVSMPSAQSDAPRPTEEHPTRVPPAKPAVQAAPSRSPMLAIAALALLGLLVLAGGS
YWLFSGSPKPPSPEQAQSDPAADDAKPPVVSEGTPGALATDGGERPLLMPGKKTLFQRVL
SKPDARLASEPGQAAQGRELPAFSVLYVYRREEQGGRTWLQVGASSDGTRDGWLAADQAS
DWKQSLVLKFTERSGRSPVMFLDSRSTLEQYLADPATARTALHQARYETAPPEVIALEPA
ANAIPQEQFYLLPIFDSAESYDAGGAPVQLLNVASIDPGDAEKVIGDGSQRYQHDKFRTG
IVLVVDTSVSMQPYIDRVVRVVDELHKQIASRGDLDNVSFGLVGFRSNVDKTPGLEYVTR
TLVTLEEGSDPQRFVDLARQVKATSVSSHAFNEDAFAGVMEAVEGMDWTPYSGRLILLVT
DAGALRKNDPLSRTQMNEAEVREAALRKQIKIYALHLRTPIGRDNHGFAEQQYRSLTADA
NPLIGDLYIPVADGEVEKFGQTVKEIGMIFAELVNQVANNQVQAPSEHQSTRSIAAKSNA
IGYAMQMDFLGRRSATQAPQLVTAWTADHDLTNPSLPAFQVCVLLTKLQLNDLQQSLKLI
VDAARRTQSSPKDFFQEIASASAYMSRDPSGLSQGRNLAESGILGEYLEGLPYRSKSLNM
TQELWLSLSVAEQQDYIDELESKIRLYETFHNDIGHWVRFGDAQPGDALYRVPLATLP
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgaaataccggggtacgagatcgagcgcgagctgggcgacggcgccatggcc
gtggtctacctggccacccagcgctcgctggagcgcaaggtcgcgctcaaggtgatggcc
gcggcgctggctgccgaccccagcttctgcgagcgcttcctgcgcgagggcaagaccctg
gcgcggctgtcccatcccaataccgtgaccatccacgacatcggcaatgtcggcagccat
tactacatggccatggagtacctgcccaacggcacgctgaaggagcgcatcgccgccggg
ctgagtgcggagcagggcatccagtacctgcgccagatcgcctcggcgctcggctatgcc
catgcccagggcctggtgcaccgcgacgtcaagccggccaacatcctgttccgcgccgac
ggcaccgcggtgctgtcggacttcggcatcgccaagtcgctggaagaccgtacccagttc
acccaggccggcttcgccgtcggcacccccagttacatgagcccggagcaggcacgcggc
caacaggtcgacgggcgtaccgacctctatgccctgggcgtggtgctctacgagattctc
accggtcagctgccctacgtcggcgccgattcgctgtccaccgcgctggcccacctcacc
cagccactgcccgagctgccgattgcccaggggcgctaccagcccatcctcagccgcctg
ctggccaaggacccggccgatcgtttccccgatgccgcggcgctgatcaaggcgctggac
gaactggccgccagcccggtcaccgcagcaaccggcggcgacagcgaagccacccagttc
cgcccgctgggcctgccggacgcgccggcgcagcgctccatgccgaccgacctcggcggc
ctgcaggcggtttcggtaagcatgccatcggcgcagagcgacgcaccgcgcccaaccgag
gagcatcccacccgcgtcccgcctgccaaacccgcggtgcaagccgcaccttcgcgcagc
ccgatgctggcgatagcggcattggcgctgctcggtctgctggtgctggccggcggtagc
tactggttgttcagcggttcgcccaaaccgccgtcacccgagcaggcgcagagcgaccca
gcggcggacgatgcgaagccgccggtggtaagcgaaggcacgcccggcgccctggccaca
gacggcggcgagcgcccgctgctgatgccgggcaagaagaccctgttccagcgcgtgctg
agcaaacccgatgcgcgtctggccagtgaacccggtcaggccgcacaggggcgcgagctg
ccggccttttcggtgctctacgtctaccgccgtgaagagcagggcggccgcacctggctg
caggtgggcgcctccagcgatggcacgcgcgacggctggctggcggcggatcaggccagc
gactggaaacagagcctggtgctcaagttcaccgagcgctccgggcgctcgccggtgatg
ttcctcgacagccgcagcaccctggagcagtacctggccgacccggccacggcccgcacg
gcgctgcaccaggcccgctacgagacggcgccgcccgaagtgatcgcgctggagccggcc
gccaacgccatcccgcaggagcagttctatctgctgccgatcttcgattcggccgaaagc
tacgacgccggcggcgcgccggtgcagctgctcaacgtggcctccatcgacccgggcgac
gccgaaaaggtgatcggcgacggcagccagcgctaccagcacgacaagttccgcaccggc
atcgtgctggtggtcgatacctcggtgtccatgcagccctacatcgaccgcgtggtgcga
gtggtggacgagctgcacaagcagatcgccagccgcggcgacctggacaacgtcagcttc
ggtctggtgggctttcgcagcaacgtcgacaagacgccggggctggagtacgtcacccgc
accctggtgaccctggaagagggcagcgacccgcagcgtttcgtcgacctggcgcgtcag
gtcaaggccaccagcgtctccagccacgctttcaacgaggatgccttcgccggcgtgatg
gaggccgtggaaggcatggactggacgccctacagcggccggctgatcctgctggtcacc
gatgccggggcgctgcgcaagaacgacccgctgagccgcacgcagatgaacgaggccgag
gtgcgcgaggcggcactgcgcaagcagatcaagatctacgcgctgcacctgcgcacgccc
atcggccgcgacaaccacggtttcgccgaacagcagtaccgcagcctgaccgccgatgcc
aacccgctgatcggcgacctgtacatcccggtggccgacggcgaggtggaaaagttcggg
cagacggtcaaggagatcgggatgatcttcgccgaactggtcaatcaggtggccaacaac
caggtccaggcgccgtccgaacaccagtccacgcgcagcatcgcggccaagagcaatgcc
atcggctatgccatgcagatggactttctcggccgccgctcggccacccaggcaccgcag
ctggtcactgcctggaccgccgatcatgacctgaccaacccctcgctaccggccttccag
gtctgcgtgctgctgaccaagctgcagctcaacgacctgcagcagtcgctcaagctgatc
gtcgacgcggcgcgccgtacccagtcctcgcccaaggatttcttccaggaaatcgccagc
gccagtgcctacatgagccgcgaccccagcggcctgagccagggccgcaacctggccgag
tccggcatcctcggcgagtacctggaagggctgccgtaccgcagcaagtcgctgaacatg
acccaggagctgtggctgtcgctcagcgtcgccgaacagcaggactacatcgacgagctg
gaatcgaagatccgcctgtacgaaaccttccacaacgacatcggccactgggtgcgcttt
ggcgatgcacaaccgggcgacgcgctgtaccgcgtgccgctggcgacgctgccctga

DBGET integrated database retrieval system