KEGG   Pseudomonas mendocina ymp: Pmen_3322Help
Entry
Pmen_3322         CDS       T00510                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Brite
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Pmen_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABP86075
UniProt: A4XXK9
LinkDB All DBs
Position
3665897..3666478
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKSLEEIVKTS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFSKVSIGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAQNYAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaactgccgccgctgccttacgaaaagaacgccctcgagccgcacatttcc
gccgagaccctggaataccaccacgacaagcaccacaacacctacgtggtgaacctgaac
aacctggtgccgggcaccgagttcgaaggcaagagcctggaagaaatcgtcaagacttcc
tcgggcggcatcttcaacaacgccgctcaggtgtggaaccacaccttctactggaactgc
ctgtcgcccaacggcggtggccagcccaccggcgccctggctgacgccatcaacgcagcc
ttcggctccttcgacaagttcaaggaagagttcagcaaggtctccatcggcaccttcggc
tccggctggggctggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggtgccggctgcccgctgacctccggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaggcgttctggaac
ctggtcaactgggacttcgtcgcccagaactacgccgcctga

DBGET integrated database retrieval system