KEGG   Pseudomonas mendocina ymp: Pmen_4192Help
Entry
Pmen_4192         CDS       T00510                                 

Definition
(GenBank) 4Fe-4S ferredoxin, iron-sulfur binding domain protein
Organism
pmy  Pseudomonas mendocina ymp
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_2 Fer4_10 Fer4_9 GF_recep_IV Fer4_6 Fer4_21 Fer4_4 Fer4_17 Fer4_8
Motif
Other DBs
NCBI-ProteinID: ABP86939
UniProt: A4Y023
LinkDB All DBs
Position
4594837..4595088
Genome map
AA seq 83 aa AA seqDB search
MSLIITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGHYDEPQCQQVCPVDCIP
LDENNVESKDELMQKYRIITGKA
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgatcatcaccgacgattgcatcaactgcgacgtctgcgaacccgagtgcccc
aacggcgccatttcccagggtgaggagatctacgtgatcgaccctaacctgtgcaccgag
tgcgtcggccattacgacgagccgcaatgccagcaggtctgcccggtggactgcatcccg
ctcgacgagaacaacgtcgagagcaaggatgaactgatgcagaagtaccgcatcatcacc
ggcaaggcctga

DBGET integrated database retrieval system