KEGG   Prevotella melaninogenica: HMPREF0659_A5100Help
Entry
HMPREF0659_A5100  CDS       T01286                                 

Definition
(GenBank) hypothetical protein
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pmz  Prevotella melaninogenica
Pathway
pmz00500  Starch and sucrose metabolism
pmz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0659_A5100
Enzymes [BR:pmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     HMPREF0659_A5100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C zf-UBP_var
Motif
Other DBs
NCBI-ProteinID: ADK95403
UniProt: D9RR62
LinkDB All DBs
Position
I:143190..145328
Genome map
AA seq 712 aa AA seqDB search
MKKTNIALIGLLMGWASIANAQTVKSPNGNVAVTFSLTGNGVPTYEMTYKGKAVVKPSHL
GLELAKNKHASKGMNETSLMDGFEKTATKTTTFDETWKPVWGETATIRNHYNELEVDLNQ
PSSKRNIVIRFRVYDDGMGLRYEFPQQPELNYFVIKDEHTQFAMAGDHTAWWLPGDYDTQ
EQETQESKLSEIRKRFHDAVNWDNSSVSVFSETGVQTSLQMKSNDGLYINIHEAACANYA
TMHLNLDDKTMTFESWLTPDATGLKGFMQTPCETPWRTVMVSDDARDMLANNLILNLNEP
CKIEDTSWIHPTKYCGVWWEMIAGGKSWAYTDEFSSVKLGQTDYAHAKPNGHHPANTANV
KKYIDFAAANGLDQVLVEGWNIGWEDWFGHWKDYVFDFVTPYPDFDLKGLNEYAHSKGVK
LMMHHETSSSTQNYERHMEDAFNLMNKYGYDAVKTGYVGDIIPRGDHHYSQSMNNHYLHV
IKEAAKHHIMVNGHEATRPTGLCRTWPNLVGNESARGTEYEAFGGSDPNHTVILPFTRLQ
GGPMDYTPGILETQLSTWCDNKSYVHTTLVGQLALYLTMYSPLQMAADLPENYQKYNDAF
QFIKDVACDWDDSRYLEAEPARYITVARKAKGTNNWFVGGKTGLAPHLSVLKLDFLDKGR
KYEATIYADAKDADYEKNPKAYTITKRTVKKGDVLKLQQVRGGGFAISLKAL
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaccaatattgcccttattgggctactaatggggtgggcaagcattgcgaat
gcgcagactgtaaagtctcctaacggtaatgttgcagttactttctcattaacagggaat
ggagtgcctacttatgagatgacttataagggtaaggctgttgtaaagccttcgcactta
ggtttggaattagctaagaacaaacatgccagcaagggcatgaacgaaaccagtcttatg
gatggtttcgagaagacagctaccaagactacaactttcgatgagacttggaagcctgtt
tggggtgagactgctaccattcgtaaccactacaatgagttggaagtagaccttaatcag
ccaagcagcaagcgtaacattgttatccgtttccgtgtttatgacgatggaatgggcctt
cgttacgaattcccacaacagccagaactgaactactttgttataaaggatgagcataca
cagtttgctatggctggcgatcatacagcttggtggcttcctggagactatgatacacag
gagcaggagacacaggaatcaaagctttctgaaatccgtaagcgtttccacgatgctgta
aactgggacaactcatctgtttctgtattctcagagacgggtgttcagacctctttacag
atgaagtctaatgatggcttgtacattaatattcatgaggcagcatgtgcaaattatgct
acaatgcacttgaatctggacgacaaaacaatgaccttcgagtcatggcttactcctgac
gctactggtttgaagggattcatgcagactccttgcgaaactccttggcgtacggtgatg
gttagcgatgatgcacgtgatatgcttgctaataaccttatcctcaatcttaacgaacct
tgtaagattgaagacacgtcatggattcatccaaccaagtactgtggcgtttggtgggag
atgattgcaggtggtaagtcttgggcttatactgatgaatttagttcagtgaagcttggt
cagactgattatgcacatgcaaagcctaacggacatcaccctgctaacaccgcaaatgtg
aagaaatacatcgactttgctgctgctaacggcttagatcaagtgttggtagaaggttgg
aacatcggttgggaagactggtttggtcactggaaagactatgtattcgatttcgttact
ccttatccagactttgatttgaaaggcttgaatgagtatgcacactctaagggtgttaag
ttgatgatgcatcatgagacttcttcaagtacacagaactatgagcgtcacatggaagat
gcctttaatttgatgaataagtatggttatgacgctgtgaagactggttatgtgggtgac
attatcccacgtggtgaccaccactattcacagtcaatgaacaaccattatctccatgtt
ataaaggaagctgctaagcatcatataatggtgaatggacatgaagcaactcgtcctacg
ggtctttgtcgtacatggcctaaccttgttggtaacgagtcagcacgtggaacagagtat
gaagcattcggtggtagtgatcctaaccacactgttatccttccatttactcgtcttcag
ggtggaccaatggattatacccctggtattcttgagactcagctctcaacatggtgtgat
aataagagctatgtacatacaactctcgtgggtcagcttgcactttatttaacgatgtat
agtccacttcagatggctgccgaccttcctgagaactatcagaagtataacgatgccttc
cagtttattaaggatgttgcttgcgactgggatgatagtcgttatcttgaggcagagcca
gcacgttatatcacagttgctcgtaaggcaaaaggcactaacaactggttcgtaggagga
aagacaggtcttgcaccacaccttagtgttctcaaactcgacttccttgataagggtcgt
aagtatgaggcaaccatctacgcagatgctaaagatgctgattacgagaagaatccaaag
gcttacaccattactaagcgcactgttaagaagggtgatgttctcaagcttcagcaggtt
cgtggaggtggttttgccatcagcttgaaagcactttaa

DBGET integrated database retrieval system