KEGG   Prevotella melaninogenica: HMPREF0659_A5292Help
Entry
HMPREF0659_A5292  CDS       T01286                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pmz  Prevotella melaninogenica
Brite
Translation factors [BR:pmz03012]
 Eukaryotic Type
  Elongation factors
   HMPREF0659_A5292 (tuf)
 Prokaryotic Type
   HMPREF0659_A5292 (tuf)
Mitochondrial biogenesis [BR:pmz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HMPREF0659_A5292 (tuf)
Exosome [BR:pmz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HMPREF0659_A5292 (tuf)
  Exosomal proteins of breast cancer cells
   HMPREF0659_A5292 (tuf)
  Exosomal proteins of colorectal cancer cells
   HMPREF0659_A5292 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW G-alpha
Motif
Other DBs
NCBI-ProteinID: ADK96396
UniProt: D9RTI7
LinkDB All DBs
Position
I:412212..413408
Genome map
AA seq 398 aa AA seqDB search
MAKEEFVRTKPHVNIGTIGHVDHGKTTLTAAISKVLHEKGFGTEDVKSFDQIDNAPEEKE
RGITINSAHIEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVNVPRLVVFLNKCDMVDDAEMLDLVEMEVREILEQYGYEEDTPIIRGSALGAL
NGVEKWVDSVMELMDTVDTWIEEPEREIDKPFLMPVEDVFSITGRGTVATGRIETGICKV
GDEVQLLGLGEDKKSVITGVEMFRKNLPTGQAGDNVGLLLRGIDKAEVKRGMVVVHPGAI
TPHDHFKASIYVLKKEEGGRHTPFGNKYRPQFYLRTMDCTGEIHLPEGVEMVMPGDNVEI
EVVLIYKVALNEGLRFAIREGGRTVGSGQITEILPDVN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaagaattcgtgcgcaccaaaccgcatgtaaacattggtactatcggtcac
gttgaccacggtaagaccactcttactgcagcaatctcaaaggttcttcacgagaagggc
ttcggtacagaagatgttaagtctttcgatcagattgataatgctcctgaggagaaagag
cgtggtattaccattaactctgcacatattgagtacgaaacagctaaccgtcactacgca
cacgtagactgtccaggtcacgccgactatgtaaagaacatggtaactggtgctgctcag
atggatggtgctatcttggttgtagctgctactgatggtcctatgcctcagactcgtgag
cacgtattgctcgctcgtcaggtaaacgtacctcgcttggttgtattcttgaacaagtgt
gatatggttgacgatgctgagatgcttgacctcgttgagatggaggttcgtgagatcctc
gagcagtacggttatgaggaggatactcctattattcgtggttctgcactcggtgctttg
aacggtgttgagaagtgggtagactctgtaatggagctcatggatactgttgacacttgg
attgaagagccagagcgtgagattgacaagccattcttgatgcctgttgaggacgtattc
tctatcacaggtcgtggtactgtagctactggtcgtatcgagactggtatctgtaaggta
ggtgatgaggttcagttgctcggtctcggtgaggacaagaagtctgttatcactggtgtt
gagatgttccgtaagaaccttccaacaggtcaggctggtgacaacgtaggtctcctcctt
cgtggtatcgataaggctgaggttaagcgtggtatggttgttgtgcacccaggtgctatt
actcctcacgatcacttcaaggcatctatctatgtattgaagaaggaagagggtggtcgt
catactccattcggtaacaagtatcgtccacagttctacctccgtacaatggactgtaca
ggtgaaatccacctcccagagggcgttgagatggttatgccaggtgacaacgtagagatt
gaagttgtattgatctataaggttgctttgaacgagggtcttcgtttcgctatccgtgag
ggtggtcgtacagtaggttctggtcagatcacagagatccttccagacgtaaactaa

DBGET integrated database retrieval system