KEGG   Prevotella melaninogenica: HMPREF0659_A6229Help
Entry
HMPREF0659_A6229  CDS       T01286                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pmz  Prevotella melaninogenica
Brite
KEGG Orthology (KO) [BR:pmz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF0659_A6229 (ahpF)
Enzymes [BR:pmz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HMPREF0659_A6229 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO Thi4 FAD_oxidored NAD_binding_8 AlaDh_PNT_C NAD_binding_7 FAD_binding_3 K_oxygenase Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADK95942
UniProt: D9RSQ3
LinkDB All DBs
Position
I:1550506..1552059
Genome map
AA seq 517 aa AA seqDB search
MLDSSILEQVKGVFGSLSSDITLSVTRNSNDENSAEFSSFVEDIASTSDKIKTVYQEGEH
FSFSILRNGEETGISFRGIPNGHEFTSLLLAILNSDGQGKNLPDEAIATRIKSLKGEIRL
QTYVSLTCTNCPDVVQALNVMALINPNISNEMVDGGLYQDEIQRLNIQGVPSVYVNGEPL
HTGRGDLGILLQELEDKVGTDHDENAVQTVREYDVIVLGGGPAGASSAIYSARKGLRVAI
VAERIGGQVNDTTGIENLISVTKTTGTQLAADLRTHINDYSIDVFDNRKVVSTNLKEAIK
TVSVRGGETFTAPAVVIATGASWRLLGLPDEDKYIGHGEHFCPHCDGPFYKGKDVAVIGG
GNSGIEAAIDLAGICRHVTVLEFADAMRADEVLQQKVASLPNVEVFLSTQTTALLGDGQK
LSGIRVKDRTNDEERDIALDGVFVQIGLSPNSDAFKDQVEVTPRNEIVIDATNRTNLSGV
YAAGDVTTVPYKQITIAMGEGAKAALSAFDDRIRGVI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttagattcaagcatactcgaacaggtgaagggcgtctttggttcgctctcatctgat
ataacccttagcgttactcgcaatagtaatgatgagaactctgcagagttttcgtctttc
gtagaggatattgcctctacttctgacaagataaagacggtttatcaggaaggagaacac
ttctcattcagtattcttcgcaatggtgaagagactggtatcagcttccgtggtatacca
aatggtcacgagtttacctcgttgctccttgctatccttaactctgacggacagggtaag
aaccttcctgacgaggcgatagctacacgtatcaagtcgttgaagggtgaaatccgcctt
cagacctacgtatcactcacctgtacaaactgtcctgacgttgttcaggcactcaacgta
atggcgcttatcaacccaaatattagcaatgagatggttgatggtggtctttatcaggat
gaaatacaacgtttgaacatacaaggcgtaccttctgtgtacgttaatggggaaccattg
cacaccggtcgtggtgatcttggtatccttctgcaagagttggaggacaaagttggtacc
gaccatgatgagaatgcggtgcaaacagtacgtgaatatgatgttatcgtactcggtggt
ggtcctgctggagcatcttctgctatctattctgctcgcaaaggcttgcgcgtagctatc
gttgcggagcgtattggaggacaggtaaacgacacaacaggtatcgagaatcttatctct
gttaccaaaacgacaggtacacagcttgctgccgaccttcgcacacatatcaatgattat
tcgattgatgtattcgacaaccgcaaggtggtatcaaccaacttgaaagaggctattaag
actgtttcagtacgtggtggagaaaccttcaccgcaccagctgttgtgattgcaacaggt
gcaagttggcgccttcttggtctgccagatgaggataaatacatcggtcatggtgagcat
ttctgtcctcattgcgatggtcctttctacaaaggtaaggacgtagcagtcatcggtggt
ggtaactctggtatcgaagcagccattgacttggctggtatctgccgccacgtgaccgta
cttgagttcgctgatgctatgcgtgctgatgaagttttacagcagaaagtagccagcctg
cctaatgttgaggtgttcctttctacccaaacaacagctctcttgggtgatggtcagaag
ctatcgggtatcagagtgaaggaccgcaccaatgatgaggaacgtgatatagccttagat
ggtgtctttgttcagattggtttgtcgccaaacagcgatgctttcaaggatcaagtagag
gttactcctcgcaatgagattgtcattgacgcaaccaatcgcactaatctaagtggcgta
tatgctgctggtgacgttacgacggtgccttacaaacagattacaattgctatgggagaa
ggtgcaaaggctgccctttcagcctttgatgaccgtatccgtggcgtgatttaa

DBGET integrated database retrieval system