KEGG   Polaromonas naphthalenivorans: Pnap_1826Help
Entry
Pnap_1826         CDS       T00459                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00010  Glycolysis / Gluconeogenesis
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
pna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnap_1826
Enzymes [BR:pna01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Pnap_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABM37136
UniProt: A1VNA8
LinkDB All DBs
Position
complement(1945022..1945921)
Genome map
AA seq 299 aa AA seqDB search
MHLPAQITPRQHAGHSALQLTTRHGTAIIALHGAHLLSWTPTGQRDVLWLSPEALPEPAA
IRGGVPVCWPWFAKQGMPASALQHGPARVLPWQVSAIHASSDDEISLSLVPCAQATGDAS
SSLAELAPGLQVSLRITLGETLSQTLHTRNLGSETFQLTQALHSYFAVSHAAQVGIEGLI
DLPYLDKLLGMTTDVQQVPFALDVACDRIYHAAQKSGDSFPGRYTLTDPAWQRRLVIETE
GSQSVVVWNPGREGARSIADVPNDGWQDFFCIEAANAGPDGVTLAPGAEHRLGQTLSIK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttccagcccagatcaccccccgccagcatgcaggccacagcgccctgcaactg
accacccgccacggcaccgccatcatcgccctgcacggcgcgcacctgctgtcgtggacg
cccacgggccagcgcgatgtgctctggctgtctcccgaggccctgcccgagcccgccgcc
attcgcggcggcgtgccggtgtgctggccgtggtttgccaagcagggcatgcccgccagc
gcgctgcagcacggcccggcgcgcgttctgccgtggcaggtcagcgcgattcacgccagc
agcgacgatgaaatcagcctgagcctcgtaccctgcgcgcaagccaccggcgatgcctcg
tccagccttgcggaactcgcgcccggtctgcaggtcagcctgcgcatcacgctgggcgaa
accctgagccagaccctgcacacgcgcaacctgggcagtgaaacttttcagctgacgcag
gccctgcacagctactttgccgtcagccacgcagcgcaggtaggcatcgaaggcctcatc
gacctgccctacctggacaagctgctcggcatgacgacggacgtgcagcaagtccctttt
gcactcgatgtggcctgcgaccgcatctaccatgccgcacaaaaatcgggcgattcgttt
ccagggcgctacacgctgaccgacccggcctggcaacgccgcctcgtgatcgagaccgaa
ggcagccagtccgtggtggtctggaacccgggccgcgaaggcgcccgcagcatcgccgac
gtgcccaatgacggctggcaagattttttctgcatcgaggcggcgaatgccgggccggat
ggagtgacgctggcgccgggagccgagcaccggctgggacagactttgagcatcaaataa

DBGET integrated database retrieval system