KEGG   Polaromonas naphthalenivorans: Pnap_2018Help
Entry
Pnap_2018         CDS       T00459                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00061  Fatty acid biosynthesis
pna00780  Biotin metabolism
pna01100  Metabolic pathways
pna01130  Biosynthesis of antibiotics
pna01212  Fatty acid metabolism
Module
pna_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Pnap_2018
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Pnap_2018
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Pnap_2018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pna01004]
    Pnap_2018
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Pnap_2018
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Pnap_2018
Lipid biosynthesis proteins [BR:pna01004]
 Fatty acid synthase
  Component type
   Pnap_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ABM37327
UniProt: A1VNU9
LinkDB All DBs
Position
2146098..2146895
Genome map
AA seq 265 aa AA seqDB search
MGFLAGKKLLITGVLSTRSIAYGIAKACHAQGAELAFSYVGERFKDRITEFAADFGSSLI
FDCDVGSDEQIDKLFVDLAKTWPTFDGFVHSIGYAPREAIAGDFLDGFSRENFRIAHDIS
AYSFPAMTKAALPYLNPKSAVLTLTYLGAERIIPHYNTMGLAKASLEASVRYLAESLGPK
GMRANGLSAGPIKTLAASGIKDFGKLLGMVAAASPMRRNVTIEDVGNVAAFLLSDLASGV
TAEITYVDCGFSATAGASRDSDSVA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcgccggcaaaaaactgttgatcacgggcgtgctgtccacccggtccatc
gcctatggcatcgccaaggcctgccatgcgcaaggggctgagctggctttcagctacgtg
ggcgagcgtttcaaggaccgcatcaccgaatttgcagccgacttcggctccagcctgatc
tttgactgcgatgtcggctccgacgagcagatcgacaagctgtttgtcgatctggccaaa
acctggccgacctttgacggctttgtccacagcatcggctacgcgccgcgcgaggcgatt
gccggcgatttcctggatggcttttcgcgcgagaacttccgcatcgcgcacgacatcagc
gcctacagctttccggccatgaccaaggccgccctgccctacctcaaccccaagtccgcc
gtgctgacgctgacctacctgggcgccgagcgcatcattccgcactacaacaccatgggc
ctggccaaggccagcctggaagcgtcggtgcgctacttggccgaatcgctcggccccaag
ggcatgcgcgccaacggcctgagcgccggcccgatcaagaccctggccgccagcggcatc
aaggatttcggcaagctgctgggcatggtggcagcggcctcgccgatgcgccgcaacgtg
accatcgaggatgtgggcaatgtggccgcattcttgcttagcgatctggccagcggcgtg
acggctgaaatcacctatgtggactgcggcttcagcgccacggccggcgccagccgcgac
agcgattccgttgcctga

DBGET integrated database retrieval system