KEGG   Polaromonas naphthalenivorans: Pnap_2128
Entry
Pnap_2128         CDS       T00459                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00362  Benzoate degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Module
pna_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pnap_2128
Enzymes [BR:pna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     Pnap_2128
SSDB
Motif
Pfam: ECH_1 ECH_2 Glycos_transf_2 DUF4351
Other DBs
NCBI-ProteinID: ABM37437
UniProt: A1VP59
LinkDB
Position
2266235..2267014
AA seq 259 aa
MKELHPILTEVRGRVGVITLNRPGQLNALNDALMDALGDALLAFDRDDAIGAIVITGSPK
AFAAGADIAAMADWSYMDVYQGDFITRNWETIRRVRKPVIAAVAGFAMGGGCELALACDL
IIAGESARFALPEIKLAMLPGAGGTQRLPRAIGKAKAMDMCLSARMLGADEADRYGLVSR
VVPDEQLLEQTLALAAKIASYSLPALMAIKESVNRSWESSLTEGILYERRELHARFASQD
AHEGMHAFLSKRTPVFEHR
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaagaactacaccccatcctgacggaagtccgtggccgggttggcgtgatcacgctg
aaccggcccgggcagctcaatgccctgaacgatgcgctcatggatgcgctgggcgacgcc
ctgctggcgttcgaccgcgacgacgcgattggcgctatcgtcatcaccggcagtcccaag
gcctttgccgccggcgcggacatcgccgccatggccgactggagctacatggacgtgtac
cagggcgacttcatcacccgcaactgggaaaccatacgccgggtgcgcaagccggtgatt
gccgccgtggccggttttgccatgggcggcggctgcgagctggcgctggcctgcgacctg
atcatcgccggcgaatcggccaggttcgcgctgcccgagatcaagctggcgatgctgccc
ggcgccggcggcacgcagcgcctgccgcgcgccatcggcaaggccaaggccatggacatg
tgcctgtcggcccgcatgctgggcgccgatgaagccgaccgctacggcctggtctcgcgc
gtcgtgcccgatgagcagctgctggaacagactttggccctggccgcgaagatcgccagc
tactccctgcccgcgctgatggcgatcaaggagtcggtcaatcgcagttgggaaagctcg
ctgaccgaaggcatcctgtatgaacgccgcgagctgcatgcgcgctttgccagccaggac
gcccacgaaggcatgcacgcctttctatccaaacgcactccggtgttcgaacaccgttga

DBGET integrated database retrieval system