KEGG   Polaromonas naphthalenivorans: Pnap_2402Help
Entry
Pnap_2402         CDS       T00459                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pna  Polaromonas naphthalenivorans
Brite
KEGG Orthology (KO) [BR:pna00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pnap_2402
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Pnap_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 DAO Glutaredoxin AlaDh_PNT_C K_oxygenase Thi4 FMO-like Lycopene_cycl DUF3467 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABM37709
UniProt: A1VPY1
LinkDB All DBs
Position
2534278..2535876
Genome map
AA seq 532 aa AA seqDB search
MLDASTKAQLKSYLDRATQPIEIVASLDAGKASGELQSLLKDIADSSALVKVSESRDDNH
RKPSFSINRPGENHGPRFAGLPMGHEFTSLILALLQVGGYPPKVDEAVLEQIRALDGDFE
FEIYVSLTCHSCPDVVQALNLMAVQNPRIKNTMIDGALFQDEVKERQIMAVPTVFLNGAE
FSQGRMSLEEILAKIDTSGVERESKKIAAKAPFDVLIVGGGPAGAAAAVYAARKGIRTGV
VSERFGGQVLDTLGIDNFISVQHTEGPQFAAALEQHVRDYEVDIMNLQRARALLPTTDAG
HALLEIQLESGASLRARSVIIATGARWRNINVPGEHEYKNKGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLAGIVGHVTLIEFDSVLRADAVLQRKLHSLKNVTVFTHAQTTEITG
DSQKVNGLIYKDRSTSELHKVELEGVFIQIGLVPNTDWLKGTVELSRHGEIVVDARGQTS
VPGVFAAGDATTVPFKQIIIAAGDGAKAALSAFDHLIRTPAPVLEMETALAD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccagcacgaaagcccaattgaaaagctacctcgaccgggccacacaaccg
atcgaaatcgtcgcctcgctcgacgctggcaaggcgtcgggcgagttgcagtcgctgctg
aaggacatcgccgactcctccgcgctggtgaaggtcagcgaaagccgcgacgacaatcac
cgcaaaccgtccttctcgatcaatcgcccgggtgaaaatcacggtccgcgttttgccggg
ctgccgatgggccacgagttcacgtcgctgatcctggccttgctgcaagttggcggctac
ccgccgaaggtggacgaagcggtcctggagcagatccgcgcgctcgatggcgacttcgag
ttcgagatctatgtctcgctgacctgccacagctgccccgacgtggtgcaggcgctaaac
ctgatggcggtgcagaacccgcgcatcaaaaacaccatgattgacggggcgctgttccag
gacgaggtcaaggaacgccagatcatggccgtgccgaccgttttcctcaacggcgccgaa
ttcagccagggccgcatgagcctggaagaaatcctggccaagatcgacaccagcggcgtc
gagcgcgaatcaaagaaaatcgccgccaaggccccgtttgacgtactcatcgtcggcggc
ggcccggccggcgcggcggctgcggtgtacgcagcgcgcaaaggcatccgcactggcgtg
gtgtcggaacgcttcggcggccaggtgctcgacacgctgggcatcgacaatttcatttca
gtccagcataccgaaggcccgcagttcgcagccgcgcttgaacagcatgtgcgcgactac
gaggtggacatcatgaacctgcagcgcgccagggcgctgcttcccaccaccgatgccggc
catgcgctgcttgaaatccagcttgaaagcggcgcgtccttgagggccagatcggtcatc
atcgccaccggagcgcgctggcgcaacatcaacgtgcccggcgagcacgaatacaagaac
aagggcgtggcctactgcccgcattgcgacggaccgcttttcaagggcaagcgcgtggcg
gtgattggcggcggcaattcaggcgtcgaggcggcgattgacctggcaggcatcgtcggc
catgtcacgctgattgaattcgatagcgtgctgcgcgccgatgccgtactgcaacgcaag
ctgcacagcctgaagaacgtgacggtgttcacccatgcccagaccaccgagatcaccggc
gacagccagaaggtcaacgggctgatctacaaggatcgttcaacaagcgaattgcacaag
gtcgaactcgaaggcgtgttcatccagatcggcctggttcccaacaccgactggctcaag
ggcacggtcgagctgtcaaggcacggcgaaatcgtggtcgatgccaggggccagacctcg
gtgcccggcgtgttcgcggcgggtgatgcgacaaccgtgcccttcaagcagatcatcatt
gcggccggtgatggcgccaaggcggcgttgagcgcgtttgaccacctgatccggacgccg
gcgcccgtgcttgaaatggaaaccgcgctggccgactga

DBGET integrated database retrieval system