KEGG   Polaromonas naphthalenivorans: Pnap_2477
Entry
Pnap_2477         CDS       T00459                                 

Definition
(GenBank) Glutathione S-transferase, C-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00480  Glutathione metabolism
pna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pnap_2477
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pna02000]
    Pnap_2477
Enzymes [BR:pna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Pnap_2477
Transporters [BR:pna02000]
 Other transporters
  Pores ion channels [TC:1]
   Pnap_2477
SSDB
Motif
Pfam: GST_N GST_N_2 GST_C GST_C_3 GST_N_3 GST_C_2 GST_N_5 GST_C_6
Other DBs
NCBI-ProteinID: ABM37781
UniProt: Q3S4C2
LinkDB
Position
complement(2615493..2616098)
AA seq 201 aa
MKLYYSPGACSLSPHIILREGGFDFQLEKVDLGTKVTETGVDYKTVNPLGSVPALQMDDG
QVLTEGPAIVQYLADRVPEKCLAPPAGSLERYRLMEWLNFISTELHKSFGALFSPVFPQD
AKPVIKTQLESRLGHAERMLGDKVWAMGEDFSVADAYLFTVLGWGTYVNLDLSPWPGLQA
YLNRVAERPAVRATLAAEGLI
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaagctttattacagtcccggcgcatgctcgttgtcgccccacatcatccttcgtgaa
ggtggatttgacttccagctagaaaaggttgatctcggcaccaaagtgactgagacgggt
gttgattacaagaccgtcaatcccttgggcagtgtccccgctctgcaaatggacgatggg
caggtgctcaccgaagggccggcgatcgtgcaatacctcgctgaccgtgtgccagaaaaa
tgcttggcaccgccagcaggctcgctggagcgctaccgactgatggaatggctgaatttc
atctccaccgaattgcacaaaagtttcggggcattgttcagcccggtgtttccacaggat
gccaagccagtcatcaagacccaattggaaagccggcttggacatgccgagcggatgctc
ggtgataaagtttgggccatgggcgaggatttttccgtggcagacgcctacctgtttact
gtgcttggctgggggacttacgtgaatctggacctttcgccttggcctggcctgcaagcc
tacctcaaccgcgtggctgaacgcccagcggtccgggcaacattggcggcagaaggtttg
atctga

DBGET integrated database retrieval system