KEGG   Polaromonas naphthalenivorans: Pnap_2481
Entry
Pnap_2481         CDS       T00459                                 

Definition
(GenBank) Glyoxalase/bleomycin resistance protein/dioxygenase
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00626  Naphthalene degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Module
pna_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Pnap_2481
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.56  1,2-dihydroxynaphthalene dioxygenase
     Pnap_2481
SSDB
Motif
Pfam: Glyoxalase
Other DBs
NCBI-ProteinID: ABM37785
UniProt: Q3S4C6
LinkDB
Position
complement(2618892..2619800)
AA seq 302 aa
MSKQAAVIELGYMGISVKDPAAWKSFAANMLGLQVLDEGDKDRFYLRMDNWHHRIVVHHN
GQDDLEYLGWRVSGQPEFDALGQKLQDAGYKVHVCDKAEAQERMVLGLMKTEDPGGNPTE
IFWGPRIDLNNPFHPGRPLHGKFLTADQGLGHCIVRQSDVEAARKFYSLLGFRGDVEYRL
PLPNGMTAELTFMHCNARDHSIAFGAMPAAKRINHLMIEYTHLEDLGYTHQLFMKNKIDI
ALQLGIHANDKALTFYGATPSGWLIEPGWRGAPSMAESEYYVGDIFGHAIEATGYGLDVK
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagcaagcaagcagcagtcattgaactaggatacatgggcatttcggtcaaggatccc
gcagcgtggaaatcctttgccgcgaacatgctggggcttcaagtcctcgatgaaggtgac
aaggaccgcttctatctgcgaatggacaattggcaccacagaatcgtggtccatcacaat
ggtcaagatgaccttgaatacttgggttggcgtgtctccggtcaaccggaattcgatgca
ttgggccaaaagctccaggacgcaggctacaaagtccacgtgtgcgacaaagccgaagca
caggaacgcatggtgctgggcctgatgaagacggaagatccgggtggcaacccgaccgag
attttctggggaccccggatagacctgaacaaccctttccaccccggtcgccccttgcac
ggcaagttcttgactgctgaccaaggcctgggccactgcatagtgcgtcagagcgacgtg
gaagcggcgcgcaagttctacagcctgctgggcttccgtggggatgtcgagtaccgcctg
cccctgcccaacggcatgaccgctgaactgactttcatgcattgcaacgctcgcgatcac
tccatcgcgttcggcgcaatgcctgcggccaagcgcatcaatcatctgatgattgaatac
acccatctggaagatctgggttatacgcaccagcttttcatgaagaacaagattgacatc
gcattgcaactgggtattcatgccaacgacaaggcgctgacgttctatggtgcaacacct
tccggctggctgatcgaacctgggtggcgaggggctccctccatggccgaatcggaatat
tacgtcggcgacatcttcggccatgctatcgaggccacaggatatggtttggacgtcaag
ctgagctaa

DBGET integrated database retrieval system