KEGG   Polaromonas naphthalenivorans: Pnap_2482
Entry
Pnap_2482         CDS       T00459                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00626  Naphthalene degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Module
pna_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Pnap_2482
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.65  salicylaldehyde dehydrogenase
     Pnap_2482
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: ABM37786
UniProt: A1VQ58
LinkDB
Position
complement(2619826..2621277)
AA seq 483 aa
MKTKLFINDAWIDSGDKKYFDRKHPVSGETMTQCANATVADAGKAAQSAQEAFKSWKAVG
PSERRRLLLKVAEVMESKTPEFIKVMAKEVGASALWAGFNVHLSANVFREAASLATQIQG
ETIPTDKADTLSMTLRQPVGPILSIVPWNGTAALAARAIAYPLVCGNTVVFKGSEFSPGT
HALIAKCVQEAGLPAGVLNYLNSSPDRSPDIADALISSKEIRRINFTGSTRVGRIIAQKA
AQHLKRCLLELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEF
VAKFVEKTKKLSAGDPCVTGDCVIGPMVSSNSGDRINGLLKDAIDKGAKVVCGGMAEGAV
MPATILDHVTADMQIYDEETFGPITVVIRCKGEADAIRIANDSVYGLSSGVFGRDVNRAL
RVGMAIEYGSVHINGSTVQNEAQAPYGGTKATGYGRFDGRAVIDEFTELKWLTIEPFEQQ
YPF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaagacgaaattgtttatcaacgacgcctggatcgattcaggtgacaaaaaatacttt
gatcggaagcaccctgtcagtggcgagaccatgacccaatgcgcgaatgcgacggtggcc
gatgcgggcaaggcggctcaatccgcccaagaggcgttcaagtcctggaaggccgttggg
ccttcggagcggaggcgccttctcttgaaggtggcagaggtcatggagagcaaaacgccc
gagttcattaaagtgatggccaaggaagtgggcgcctccgcgctatgggcggggttcaac
gtgcacctgtcggccaatgtgttccgggaagccgcctcactggccacgcaaatacaaggt
gaaaccattccgacggacaaggctgacaccctgtcgatgacgctgcgtcaaccggtcggc
cccatcttgagtatcgtgccatggaacggcaccgcagcgctcgcggcgcgggccatcgcg
tatccgttggtctgcggcaataccgtggtgttcaaaggctccgagttcagccccggcacg
cacgcgttgatcgcgaagtgcgtacaggaggccggcctgcccgctggcgtgctcaattat
ctgaactcgtccccggaccgctcgcccgatatcgccgatgcgctgatttcgtctaaagag
attcgtcgcatcaactttacgggctccactcgcgtggggcgcatcatcgcccagaaagcg
gcccaacatctcaagcgctgcttgctggagttgggtggcaagtccccgctgatcgttctg
gacgacgcggacatcgacgcggcggtcaaggcagcggtgtttggcagtttcctgttccaa
ggccagatctgcatgtccaccgaacgcctggtggtcgacgagaagatcgcggacgaattt
gtcgcgaagttcgtcgagaaaaccaagaagttgagtgcaggcgatccgtgcgtgaccggg
gactgcgtcattggtccgatggtgtcgtccaactcgggggaccggatcaatggcctgttg
aaagatgccatcgacaagggtgccaaggtcgtgtgcggtggtatggccgagggtgcggtc
atgcccgccacgatcctggaccacgtgacagccgacatgcagatctacgatgaggaaacc
ttcggtcccatcaccgtggttatccgttgcaagggcgaagcagacgccatccgcattgcc
aatgacagcgtctatggcctgtcatcgggcgtgtttggccgggacgtcaaccgggccctg
cgcgtgggtatggcgatcgaatacggctcggtccatatcaacgggtctaccgtgcagaac
gaggcgcaggcgccttatggcggcacaaaggccaccggttatggccgcttcgatggacgc
gcggtgatcgacgagttcacggagctcaaatggctaaccattgaaccgttcgaacagcag
tatcccttctaa

DBGET integrated database retrieval system