KEGG   Polaromonas naphthalenivorans: Pnap_4141Help
Entry
Pnap_4141         CDS       T00459                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K10222  2,6-dioxo-6-phenylhexa-3-enoate hydrolase [EC:3.7.1.8]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00621  Dioxin degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Pnap_4141
Enzymes [BR:pna01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.8  2,6-dioxo-6-phenylhexa-3-enoate hydrolase
     Pnap_4141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Esterase DUF915 Ndr AvrE_T3Es
Motif
Other DBs
NCBI-ProteinID: ABM39428
UniProt: A1VUV0
LinkDB All DBs
Position
pPNAP01:complement(15986..16846)
Genome map
AA seq 286 aa AA seqDB search
MTALTESSTSKFVKINEKGFSDFQIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNIGAFV
EAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALN
FALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQS
LITEELLQGRWEAIQRNPEHLKNFLVSAQKAPLSTWDVSARLGEIKAKTFITWGRDDRFV
PLDHGLKLVWGINDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgactgcactcaccgaaagttccaccagcaagttcgtgaaaatcaatgaaaaaggtttt
tccgacttccagattcattacaacgaggcgggcaatggcgaaaccgtcatcatgctgcac
gggggcggccctggcgctggcggctggagcaactactaccgcaacatcggcgcgttcgtc
gaggccggctaccgggtgatcctgaaggactcgcccggcttcaacaagtcggacgcggtg
gtgatggacgagcagcgtggcctggtcaacgcccgtgccgtcaaaggtctgatggacgcg
ctggacatcgaccgggcgcacctggtcggcaactcgatggggggcgccacggcgctgaac
ttcgcgctcgaataccccgaccgcatcggcaaactgatcctcatggggcccggcggcctg
ggccccagcatgttcgcgccgatgccgatggaaggcatcaagctgctgttcaagctgtat
gccgagccgtcctacgagacgctgaaacagatgcttcaggtgtttttgtacgaccagtcc
cttatcaccgaggagttgctgcagggccgctgggaagccattcagcgcaacccggagcac
ctgaagaacttcctcgtcagcgcgcaaaaggcgccgctctcgacttgggacgtgtcggcc
cggctgggcgaaatcaaggccaagacattcatcacctgggggcgcgatgaccgcttcgtt
ccccttgaccatggcctgaagctggtctggggcatcaacgacgcgcgcttgcacgtgttt
tccaagtgcggccactgggcgcaatgggagcatgccgatgaattcaaccgcctggtgatt
gacttcctgcggcacgcgtaa

DBGET integrated database retrieval system