KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0473Help
Entry
NCGM2_0473        CDS       T01974                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01130  Biosynthesis of antibiotics
pnc01230  Biosynthesis of amino acids
Module
pnc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCGM2_0473 (aroK)
Enzymes [BR:pnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NCGM2_0473 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin AAA_33 Cytidylate_kin2 AAA ABC_tran AAA_16 AAA_22 AAA_24 Rad17 APS_kinase dNK TsaE AAA_5 RuvB_N CHDNT RNA_helicase AAA_29 RsgA_GTPase AAA_25
Motif
Other DBs
NCBI-ProteinID: BAK87363
LinkDB All DBs
Position
1:520476..520994
Genome map
AA seq 172 aa AA seqDB search
MVNLILVGPMGAGKSTIGRLLAKELHLAFKDSDKEIEQRCGANIPWIFDVEGEVGFRERE
QAMLTELCAADGMVIATGGGAVMRDGNRQVLRAGGRVVYLHASVEHQIARTARDRNRPLL
QKPNPGQILRDLMALRDPLYREIADVVVETDERPPRLVVQEILERLRKLPPR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaacctgatcctcgtcggcccgatgggtgctggaaagagcaccatcgggcgcctg
ctcgccaaggagctgcatctcgcgttcaaggactccgacaaggagatcgaacagcggtgc
ggcgcgaatatcccatggatcttcgatgtcgagggcgaggtcggtttccgcgagcgcgag
caggccatgctcaccgaactctgcgccgccgacggcatggtgatcgccaccggcggcggg
gcggtgatgcgcgacggtaaccgccaggtgctgcgcgccggtggccgggttgtgtacctg
catgcctcggtcgagcaccagatcgcgcgcacggcgcgggaccgcaaccgccccttgttg
cagaagcccaacccgggacagatcctccgcgacctgatggcgctgcgcgacccgctctac
cgcgaaatcgccgatgtggtggtggagaccgacgaaaggccgccgcgcctggtcgtccag
gaaattctcgaacgcctgcgcaagttgccgccccgctga

DBGET integrated database retrieval system