KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0592Help
Entry
NCGM2_0592        CDS       T01974                                 

Gene name
alr
Definition
(GenBank) biosynthetic alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00473  D-Alanine metabolism
pnc01100  Metabolic pathways
pnc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCGM2_0592 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NCGM2_0592 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pnc01011]
    NCGM2_0592 (alr)
Enzymes [BR:pnc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NCGM2_0592 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:pnc01011]
 Precursor biosynthesis
  Racemase
   NCGM2_0592 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Herpeto_peptide
Motif
Other DBs
NCBI-ProteinID: BAK87480
LinkDB All DBs
Structure
PDB: 

Position
1:662125..663216
Genome map
AA seq 363 aa AA seqDB search
MRPLVATVDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALHDDADGFAVAC
LEEAAEVRALHASARILLLEGCFEASEYALAGQLRLDLVIQGAEQGEAFLAAGLDIPLNV
WLKLDSGMHRLGFDPAALRAWHARLRSHPGVRELNLISHFACADERNHPLTEQQLESFLG
LLDLDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGSTPLADLSAAELGLRPAMSLGAQL
ISLREVAVGESVGYGATWIAERPARIGTVSCGYADGYPRTAPAGTPVLVGGRRATLAGRV
SMDMLAVDLSDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVGARVPRAFQYGP
GRL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccctcgttgccaccgtcgacctttccgccattcgccacaactatgccctggcc
aagcgctgcgcgccgcagcgccaggcgttcgcggtggtcaaggcgaacgcctatggccac
ggtgcgcgcgaagtggttaccgcgttgcacgacgatgccgatggcttcgccgtggcctgc
ctggaggaggccgcggaagtccgcgccttgcacgccagcgcgcgcatcctgttgctggaa
ggctgcttcgaggcgagcgaatacgccctcgccgggcaattgcgcctggacctggtgatc
cagggcgcggaacagggcgaggcgttcctcgccgccggcctggatattccactcaacgtc
tggctcaagctcgactccggcatgcaccgcctgggcttcgatcctgccgcgctgcgcgcc
tggcatgcgcgcctgcgcagccatcccggtgtgcgcgagctgaacctgatcagccatttc
gcctgcgccgacgaacgcaaccatccgctcaccgaacagcagctggagagtttcctcggc
ctgctcgacctggacttcgaccagcgcagcctggccaattcggcggcggtgctgactatc
ccagccgcccacatggactggctgcggccgggaatcatgctctacgggtcgaccccgctg
gccgacctgagtgccgccgaactgggcctgaggccggccatgagcctgggcgcgcagttg
atttcgctgcgcgaggtggccgtgggcgagagcgtcggctacggcgccacctggatcgcc
gagcggccggcgcggatcggcacggtcagttgcggctacgccgacggctacccgcgcacc
gcgccagccgggactccggtactggtcgggggacgccgcgcgaccctggccgggcgggtc
tcgatggacatgctggcggtcgacctctccgacctgccggaggctcgcgttggcgacccg
gtggagttgtggggcgccgggttgtcggtggacgaggtcgcccgtgcctgcggcaccctc
ggctacgagcttctgagcaaggttggtgcgcgggttccgcgtgccttccagtacggacct
ggccgcctatag

DBGET integrated database retrieval system