KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_1049Help
Entry
NCGM2_1049        CDS       T01974                                 

Gene name
pilS
Definition
(GenBank) two-component sensor
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCGM2_1049 (pilS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pnc01001]
    NCGM2_1049 (pilS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pnc02022]
    NCGM2_1049 (pilS)
   02035 Bacterial motility proteins [BR:pnc02035]
    NCGM2_1049 (pilS)
Enzymes [BR:pnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     NCGM2_1049 (pilS)
Protein kinases [BR:pnc01001]
 Histidine kinases
  NtrC family
   NCGM2_1049 (pilS)
Two-component system [BR:pnc02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   NCGM2_1049 (pilS)
Bacterial motility proteins [BR:pnc02035]
 Pilus system
  Twitching motility proteins
   NCGM2_1049 (pilS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_8 HATPase_c_2 PAS PAS_7 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: BAK87924
LinkDB All DBs
Position
1:complement(1148741..1150333)
Genome map
AA seq 530 aa AA seqDB search
MRAERLRLSEEQGQRILRLYHLYRLTIGLVLVLLISSELEDQVLKLVHPELFHVGSWCYL
VFNILVALFLPPSRQLLPIFILALTDVLMLCGLFYAGGGVPSGIGSLLVVAVAIANILLR
GRIGLVIAAAASLGLLYLTFFLSLSSPDATNHYVQAGGLGTLCFAAALVIQALVRRQEQT
ETLAEERAETVANLEELNALILQRMRTGILVVDSRQAILLANQAALGLLRQDDVQGASLG
RHSPMLMHCMKQWRLNPSLRPPTLKVVPDGPTVQPSFISLNREDDQHVLIFLEDISQIAQ
QAQQMKLAGLGRLTAGIAHEIRNPLGAISHAAQLLQESEELDAPDRRLTQIIQDQSKRMN
LVIENVLQLSRRRQAEPQQLDLKEWLQRFVDEYPGRLRNDSQLHLQLGAGDIQTRMDPHQ
LNQVLSNLVQNGLRYSAQAHGRGQVWLSLARDPESDLPVLEVIDDGPGVPADKLNNLFEP
FFTTESKGTGLGLYLSRELCESNQARIDYRNREEGGGCFRITFAHPRKLS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgctgaacggctacggctgagcgaggagcaggggcaacgcatcctccgtctgtac
cacctataccgcctgaccatcggcctggtactggtcctgctgatctccagcgaactggaa
gatcaggtcctcaagctcgtccaccctgaactgttccatgtcggcagttggtgctacctg
gtcttcaacatcctggtcgcgctgttcctgccgccgtcgcggcaattgctgccgatcttc
atcctcgcgctcaccgacgtgctgatgctttgcggcctgttctacgcaggtggcggcgtg
cccagcggcatcggcagcctgctggtggtggcggtggccattgccaacatcctgctacgc
gggcgcatcggcctggtcatcgcggcggcggccagcctcggcctgctctacctgaccttc
ttcctcagcctgagcagtccggacgccaccaaccactacgtccaggccggcggcctcggc
accctgtgcttcgccgccgcgctggtgatccaggctctggtgcggcgccaggagcagacc
gaaacgctggccgaagaacgcgccgagacggtcgccaacctggaggaactcaacgcattg
atcctgcagcgcatgcgcaccggcatcctcgtggtcgatagccgtcaggccatcctcctc
gccaaccaggccgccctcggcctgctcaggcaggacgacgtgcagggcgccagcctcggc
cgccacagcccgatgctgatgcactgcatgaagcaatggcgcctgaatcccagcctccgt
ccgccgacgctcaaggtggtgccggatggcccgacggtgcaacccagctttatcagcctc
aaccgcgaagacgaccagcacgtgctgatcttcctcgaagacatttcgcagatcgcccag
caggcgcagcagatgaagctggccggtctcggccgcctgaccgccggcatcgcccatgag
atccgcaacccgctgggcgcgatcagccacgccgcccaactgctgcaggagtcagaggaa
ctggatgccccggaccgacggctgacgcagatcatccaggaccagtcgaagcggatgaac
ctggtcatcgagaacgtcctgcagctttcccgtcgccgccaggccgaaccgcagcagctc
gacctgaaggagtggcttcagcggttcgtcgacgaatatcccggcaggctgcgcaacgac
agtcaactgcacctgcagctcggtgccggcgacatccagacccgcatggacccacaccag
ttgaaccaggtgctgagcaacctggtgcagaacggtcttcgctacagcgcccaggcgcac
gggcgtggccaggtctggctgagcctcgcgcgcgacccggagagcgacctgccggtgctg
gaagtcatcgacgacggtcccggcgtaccggcggacaaactgaacaacctgttcgaaccc
ttctttactacagaaagcaaaggcaccggcctgggcctctatctctcccgcgaactctgc
gagagcaaccaggcacggatcgactaccgcaatcgcgaggaaggcggcggctgcttccgc
atcaccttcgcccacccgcgcaaactcagctga

DBGET integrated database retrieval system