KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_1413
Entry
NCGM2_1413        CDS       T01974                                 

Definition
(GenBank) hypothetical protein
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
SSDB
Motif
Pfam: UPF0242 Mod_r YabA Golgin_A5 CENP-F_leu_zip Macoilin FUSC RNase_Y_N DUF3450
Other DBs
NCBI-ProteinID: BAK88279
LinkDB
Position
1:complement(1561502..1562911)
AA seq 469 aa
MRSNGLLKWLLIPVALLVLFVAIRLFSGGGASAPPTADGSSRLTPEEMKALGIEGDTPRD
TVATLVAQVKQLRTELQTALSDNRSQREENQRLRQREGAIDQRISSALESERSDLRRDQQ
QAASTRQQTEGLLADLQQRLDSIGGRGGGHADLPVGLGLRDGDEAGMEGGMRWVEPDDAK
QSDGRGRSNGGISFPTSFGSAQSTLETTAQTVANAGARAAGVKSATPVYTVPTNSTLMGS
VAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLSCVR
GQVRSITFVFHDGTIRTIPEDREGNQQNNQQRDGLGWISDPHGIPCVSGERRSNAQQYLG
TQALITAAGAGVASLIESDNGRASYVGADGSIGSVGISGQEAVGRILASGVQDMSSWVNK
LYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGDSHALELE
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgcgcagtaacggtctcctgaagtggctgctgatccccgtggccctgctggtgctgttc
gtcgccatccggctgttctccggtggcggtgcgtcggcgccgcccaccgcagatggcagc
agcaggctcacgccggaggaaatgaaggcgctgggcatcgagggcgataccccgcgcgac
accgtggcgacgctggttgcccaggtgaagcagttgcgcaccgagcttcagaccgcgctg
tccgacaacaggtcgcagcgcgaggagaatcagcgactgcgccagcgcgagggcgccatc
gaccagcgcatcagttcggccctcgaatccgaacgctccgacctgcgccgtgaccagcag
caggcggccagcacgcgccagcagaccgaggggctgctcgccgacctgcagcagcgcctg
gacagcatcggcggacgtggcggtggccatgccgatttgccggtggggctgggcctacgt
gacggcgacgaggccggcatggaaggcggtatgcgctgggtggagcccgacgacgcgaaa
caaagcgacgggcgcggcaggtcgaatggcggcataagcttccccaccagcttcggttcc
gcacagagcacgctggaaaccacagcgcaaaccgtggcgaacgcgggcgcacgcgccgct
ggcgtcaagagcgcgacgcccgtctataccgtgccgaccaactcgacgctgatggggtcg
gtggcaatgacggcgctgattggccgcgtgccgatcgacggcacggtgaacgatccatac
cccttcaaggtcttggtcgggcctgacaatttgaccgcgaacggtatcgacattcccgat
gtggccggagccgtgttctccggcaccgcatcgggcgactggacgctctcgtgcgtgcgc
ggccaggtgcgcagcatcaccttcgtgttccatgacgggaccatccgcaccattcccgag
gatcgcgagggcaaccagcagaacaaccaacaacgtgacggcctgggctggatcagcgac
ccgcacggcattccctgtgtcagcggcgagcggcgcagcaatgcgcagcagtaccttggc
acccaggcgctgatcacggcggctggcgctggcgtggcctcactcatcgaatccgacaac
ggcagggcgtcctatgtcggcgccgacggctccatcggcagcgtgggcatcagcggccag
gaggccgtggggcggattctcgccagtggcgtccaggacatgtcgagctgggtcaacaag
ctctacggccaggccttcgctgccgtttatgtgcagcccggtgccaaggtcgccgtccac
ctcgaaaagccgctcgccatcgacttcgacccagaaggccgcaaggtcgatcaccgcgca
ggagacagccatgctctcgaacttgaatag

DBGET integrated database retrieval system