KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5300Help
Entry
NCGM2_5300        CDS       T01974                                 

Gene name
phlE
Definition
(GenBank) major facilitator transporter
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr Nuc_H_symport MFS_1_like LacY_symp
Motif
Other DBs
NCBI-ProteinID: BAK92121
LinkDB All DBs
Position
1:5677611..5678870
Genome map
AA seq 419 aa AA seqDB search
MAHNNNSASYENVLLCVLFLTFGFVFFDRLALSFLFPFMEQELQLSNSHLGMLSSVLALA
WAVSGALVGAWSDRRGQRKPLLIVAVILFSLCSALSGLVGGFLSLLLFRGIMGLAEGPIL
PLSQSLMVEASSPHRRGLNMGLLQGSAAGLLGAVIGPPLLVALAEALGWRHAFIVSLLPG
LLIAWLIWRHVRPDPPRAQRPAPRAEEAKGKRLALLKSRNILLCTLISCVFVTWFIVLIS
FTPTFLVNARGFSPATMGRLMSCLGVAWVVWGFAVPAISDRIGRRPTLVAFSLLAACCPL
ALLYAPNATSLGLLLLLTYTGLGCFTLFMATIPAETVSRSVIATALGLIMGLGELVGGFL
APTVAGFAADRFDLSIVMWMSCGGALLAAFLSLFLRETAPAVLARQRSAPTSVLQGNQP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataacaacaattccgccagttacgaaaacgtcctgctctgcgtgctgttcctg
accttcggcttcgtcttcttcgaccgcctggcgctgtccttcctgtttcccttcatggaa
caggagctgcaactgagcaacagccacctgggcatgctctcctcggtgctggccctggcc
tgggcggtatccggcgcgctggtcggcgcctggtccgaccgccgcggccagcgcaagccg
ctgctgatcgtggcggtgatcctgttctcgctgtgctcggcgctgtccgggctggtcggc
ggcttcctcagcctgctgctgttccgtggcatcatgggcctggccgaggggccgatcctg
ccgctctcgcaatcgctgatggtcgaggcctcctcgccgcatcgccgcggcctcaacatg
ggcctgctacagggctcggcggccggcctgctcggcgcggtgatcggcccgccgctgctg
gtggccctggccgaagccctcggctggcgtcacgccttcatcgtctcgttgctgccgggc
ctgctgatcgcctggctgatctggcgccatgtgcgtcccgacccgccccgtgcgcagcgc
ccggcgccgcgcgcagaagaagcgaaaggcaagcgcctggcactgctgaagagccgcaac
atcctgctctgcaccctgatcagttgcgtattcgtcacctggttcatcgtgctgatttcc
tttaccccgaccttcctggtcaacgcccgcggcttcagcccggcgaccatgggcaggctg
atgagctgcctgggcgtcgcctgggtggtctggggcttcgccgtaccggcgatatccgat
cgcatcggccgtcggccgaccctggtggcgttctccctgctcgccgcgtgttgcccgctg
gcgctgctctatgcgccgaacgcgaccagcctcggcctgctgttgctgctgacctacacc
gggctcggctgcttcaccctgttcatggcgaccatcccggcggagaccgtctcgcgcagc
gtcatcgccaccgccctcggcctgatcatgggcctcggcgaactggtcggcggtttcctc
gcgccgaccgtggccggcttcgccgccgaccgcttcgacctgtccatcgtcatgtggatg
tcctgcggcggcgccctgctcgccgcgttcctctcgctgttcctgcgcgaaaccgcgccc
gccgtgctggcgcgccagcgcagcgcgcctacctccgtcctgcaaggaaaccaaccatga

DBGET integrated database retrieval system