KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5302Help
Entry
NCGM2_5302        CDS       T01974                                 

Definition
(GenBank) putative short-chain dehydrogenase
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR RmlD_sub_bind Oxidored_nitro GDP_Man_Dehyd DFP
Motif
Other DBs
NCBI-ProteinID: BAK92123
LinkDB All DBs
Structure
PDB: 

Position
1:5679940..5680665
Genome map
AA seq 241 aa AA seqDB search
MVFQHDIYAGQQVLVTGGSSGIGAAIAMQFAELGAEVVALGLDADGVHAPRHPRIRREEL
DITDSQRLQRLFEALPRLDVLVNNAGISRDREEYDLATFERVLRLNLSAAMLASQLARPL
LAQRGGSILNIASMYSTFGSADRPAYSASKGAIVQLTRSLACEYAAERIRVNAIAPGWID
TPLGAGLKADVEATRRIMQRTPLARWGEAPEVASAAAFLCGPGASFVTGAVLAVDGGYLC
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggttttccagcacgatatctacgccggccagcaggtgctggtcactggcggcagctcc
ggcatcggcgcggccatcgccatgcagttcgccgaactcggcgccgaagtcgtcgccctc
ggcctggacgccgacggcgtgcacgcaccgcgtcatccgcggattcgccgggaagaactg
gacatcaccgacagccagcgcctgcaacggctgttcgaagcgctgccgcgcctggatgtg
ctggtgaacaacgccggcatcagccgcgaccgcgaggaatacgacctggcgaccttcgaa
cgggtgctgcgcctcaacctgagcgccgccatgctcgccagccaactggcccgtccgctg
ctggcacagcgcggcggcagcatcctcaacatcgcctcgatgtacagcaccttcggttcc
gccgaccgcccggcctacagcgccagcaagggcgccatcgtccagctcacccgttccctg
gcctgcgagtatgccgccgagcgcatccgggtcaacgccatcgcccccggctggatcgac
acgccgctgggcgccgggctcaaggccgacgtcgaggccacccgccggatcatgcagcgc
acgccgctggcgcgctggggcgaggcgcccgaggtggccagcgccgcggccttcctctgc
ggtcccggcgccagcttcgtcaccggcgccgtgctggcggtggacggcggctatctctgc
gcctga

DBGET integrated database retrieval system