KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5303Help
Entry
NCGM2_5303        CDS       T01974                                 

Definition
(GenBank) hypothetical protein
  KO
K07267  porin
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pnc02000]
    NCGM2_5303
Transporters [BR:pnc02000]
 Other Transporters
  Pores ion channels [TC:1]
   NCGM2_5303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OprB
Motif
Other DBs
NCBI-ProteinID: BAK92124
LinkDB All DBs
Position
1:5680750..5682054
Genome map
AA seq 434 aa AA seqDB search
MKTLRTLPALLCAGFLGLSAQAAEDSRSGPLAGFGERLQRHGVKTHAQFWSLSLKNLDTG
PRQHSFGNSGDLFLGADLDLATLAGLDGASLHIEETLFILDRGTGQPTGPSWQGAVGSYF
GGAPLHNDIGANQLSLLTWQQQWLGGRLDSHLGRTNARRYFLIYNCETVVTCNDPIIDAS
TGILPPPYGAWGGYLKYRATPTLYLHAGAFESNPVDYLKKRHGLDFGTDDASGTSLLLGI
GDKREESLDPYRSHYELNAYLNTANQVDPLTGASDHGSAGGFFKFQQLFWRADGGRLDSP
RALGLFGSLSVSADDKQPFRHFAELGLTYHAPFDRTRDKLNLKASYLRLNDHQLEFQRQA
RIAAGGDAKLGQRDVYALETNAHIALTPHIALEPSVQYIFNPDNYYNPGARELSGDGFVV
GLQLMVDMGSLLGL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccctccgcaccttgccggcgctgctctgcgccggtttcctcggtctctccgcg
caggccgccgaagacagccgcagcggcccgctggccgggttcggcgaacgactccagcgc
cacggcgtgaagacccacgcgcagttctggagcctgtcgctgaagaacctcgacaccggc
ccgcgccagcacagcttcggcaacagcggcgacctgttcctcggcgccgacctcgacctc
gccaccctcgccggcctggacggcgcctcgctgcacatcgaggaaaccctgttcatcctc
gaccgcggcaccggtcagcccaccgggccgagctggcagggcgcggtgggcagctacttc
ggcggcgcgccgctgcacaacgacatcggcgccaaccagctgagcctgctcacctggcag
cagcagtggctgggcggacgcctcgacagccatctcggacgcaccaatgcgcggcgctat
ttcctgatctacaactgcgagaccgtggtcacctgcaatgacccgatcatcgacgcctcc
accggcatcctgccgccgccctacggcgcctggggcggctacctgaagtaccgggcgacc
ccgaccctgtacctgcacgccggggccttcgagtccaacccggtggattacctgaagaag
cgccatggcctcgatttcggcaccgacgacgccagcggcaccagcctgctgctggggatc
ggcgacaagcgcgaggaaagcctcgatccctaccgctcgcactatgaactcaacgcctac
ctgaacaccgccaaccaggtcgacccgctcaccggcgccagcgaccacggcagcgccggc
ggcttcttcaagttccagcagctgttctggcgcgccgacggcggccgcctcgattcgccg
agggcgctggggctgttcggctcgctgtcggtatcggccgacgacaagcagccgttccgt
catttcgccgagctgggcctgacctaccatgcgccgttcgaccgcacgcgggacaagctc
aacctcaaggccagctacctgcgcctgaacgaccaccagctggagttccagcgccaggcg
cggatcgccgccggcggcgacgcgaaactcggccagcgcgacgtgtacgccctggaaacc
aatgcgcacatcgcactgaccccgcacatcgcgctggagccgtcggtgcagtacatcttc
aacccggacaactactacaaccccggcgcccgcgaactgagcggcgacggtttcgtcgtc
ggcctgcaactgatggtcgacatgggctcgctgctggggctttag

DBGET integrated database retrieval system