KEGG   Polynucleobacter necessarius: Pnec_0175Help
Entry
Pnec_0175         CDS       T00683                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00550  Peptidoglycan biosynthesis
pne01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pnec_0175
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Pnec_0175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pne01011]
    Pnec_0175
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pne03036]
    Pnec_0175
Enzymes [BR:pne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Pnec_0175
Peptidoglycan biosynthesis and degradation proteins [BR:pne01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Pnec_0175
Chromosome and associated proteins [BR:pne03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    Pnec_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ACB43480
UniProt: B1XT03
LinkDB All DBs
Position
153188..154960
Genome map
AA seq 590 aa AA seqDB search
MRPVGFSTTPNLVLRLPMWRSRLMLFLLFFVFMMLLLRAFWIQGPGNAFYEAKGVRGTQR
ELELPASRGKILDRNGQVIATSLEAKSVIAYNDAVPDDLAADKVQKLASLLQISEADLRK
KLKEERKQIFLKRQVDPAVAQQIKQLEIPGIGLNNEYRRFYPEGEAMAHVVGFTNVNDKG
QEGMELSRENDLASHPGQRRVVVDRLGRVVEDVAILQLPQNGKDLNLSIDSKIQFLAYNA
VKDAVEKHHAKAGGAVVLDTQTGEILALANYPSYNPNDRRFLTGEQLRNRVLTDTFEPGS
TMKPLTIAIALEKGSVKSDTNMVIGAKYLVGPKPITDTHPYGNLTVAQIIQKSSNIGTAK
IAMNNLSAEEMWDFYTTVGLGQAPKIGFPGAVAGTVHPFKKWMPTDQARIAFGYGISASL
FQVARAYTVFARDGELVPLTIERSPEFKPGIKVLSPKTAIEMRNMMEAVTEPGGTAIKAQ
AEGFRVGGKTGTAHKLVGKGYSNKYRAYFAGLAPISAPRIVVAVMIDEPTGGSHYGGDVA
APVFSTIVSETLHTLNVLPDSKVKQMVLQDKSSQEIQTANAQAQHVVLKR
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggtaggtttttccaccactcctaacttagtgttgcgtctgccaatgtggcgg
tcgcgcttgatgctattcctcttgttcttcgttttcatgatgctattgttgcgtgcattt
tggattcagggcccaggaaatgcattttatgaagccaaaggcgtacgtggcactcaacgc
gaattagagctacccgctagccgtggaaaaattttggaccgcaacgggcaagttattgcc
accagtctggaggcgaagtcagtcatcgcttataatgatgcggtgcccgatgatttagca
gcagataaagttcagaagttagcaagtcttttgcaaataagtgaagcagatttgcgtaaa
aaattaaaagaagagcgcaagcaaatctttttaaagcgtcaggtagatccagcggttgca
caacagattaagcagttggaaatcccaggcattggtttaaataatgaatatcgtcgcttc
tatccagaaggcgaggcgatggctcacgtagttggctttacaaacgtcaacgataagggt
caggaaggcatggagctttctcgcgagaatgaccttgctagtcatcctggtcaaagacgt
gtagtggttgatcgcttagggcgtgtcgtagaagatgttgcaatcttgcagttgccgcaa
aacggaaaagatttaaatctatccattgatagcaaaattcagttcttggcatataacgct
gtgaaagatgcagttgaaaagcatcacgctaaggcgggcggtgctgtcgtacttgatacg
cagaccggtgaaattttagccttagcaaattacccaagctataacccgaatgatcgaagg
tttttaacgggcgagcaattacgtaatcgtgtcttgactgatacttttgagccaggctca
actatgaagcctttaactattgcgattgctttagagaagggttctgttaagtcggacact
aatatggtaattggtgccaaatatttagttggccctaaaccaatcacagatacacatccg
tacggtaacttaacagtcgcgcaaattattcaaaagtctagcaatattggcaccgcaaaa
attgctatgaataatctttctgctgaagaaatgtgggatttctataccacagttggcttg
ggtcaagcaccaaaaattggcttccccggtgccgttgctggaactgtgcatccatttaaa
aagtggatgcctaccgatcaagcgcgcattgcatttggttatggtatttcagcgtcactc
tttcaggtggcgcgtgcttacaccgttttcgcacgtgatggcgagttggttcctttgaca
attgaacgtagtccggaatttaagccgggtattaaggttctttctccaaaaactgcaatt
gaaatgcgcaacatgatggaggcggttactgagcctggtggcacggcaattaaagctcaa
gctgaaggattccgtgttggtggaaaaaccggaacagcgcataaattagttggcaagggt
tatagcaataaataccgtgcatactttgcggggttggcaccaatcagtgcgccacgcatt
gttgtagcggtgatgattgatgagcctactggtggcagtcactacggtggtgatgtggcg
gcgccagtgttttcgacaattgtgagcgaaacattacatactttaaatgttttgccggat
agcaaagtcaagcaaatggtattgcaggataagagttctcaggagattcaaactgcaaat
gctcaagctcaacatgtggttttgaagcgatga

DBGET integrated database retrieval system