KEGG   Polynucleobacter necessarius: Pnec_0369Help
Entry
Pnec_0369         CDS       T00683                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00020  Citrate cycle (TCA cycle)
pne00480  Glutathione metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01130  Biosynthesis of antibiotics
pne01200  Carbon metabolism
pne01210  2-Oxocarboxylic acid metabolism
pne01230  Biosynthesis of amino acids
Module
pne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pne_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pnec_0369
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pnec_0369
Enzymes [BR:pne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Pnec_0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ACB43654
UniProt: B1XTH7
LinkDB All DBs
Position
332535..334769
Genome map
AA seq 744 aa AA seqDB search
MASEKSKIIYTLTDEAPLLATCAFLPIIRTFTAPAGVEIVKSDISVAARILAEFNDCLTP
EQQVLDNLGALGKMTLLPDINIIKLPNISASVPQLLAAIKELQSKGYKIPDFPEDPKTDE
EKSIRTRYSKCLGSSVNPVLREGNSDRRAPPAVKRYARKNPHSMGEWSQASRTHVSHMHG
GDFYSSEKSMTMTKACDVKMDLVTKSGKTIVLKPKVSLLAGEIIDSMYMSKKALCEFYEK
EIEDAYKTGMMLSLHVKATMMKVSHPIVFGHAVKIFYKDAFEKHAKLFEELSVNVNNGMS
SLYEKIKTLPESKREEIIQDLHACYEHRPALAMVDSAKGITNLHSPSDVIVDASMPAMIC
VGGKMWGADGRLHDTKAVIPESTFARIYQEMINFCKTHGNFDPKTMGTVPNVGLMAQQAE
EYGSHDKTFEIPEAGVARIVADDGTVLLEQNVEEGDIWRMCQVKDAPIRDWVKLAVNRAR
LSNTPAVFWLDEYRPHEAELIKKVNTYLKDYDLTGVDIQIMSQTRAMRYTLERVIRGKDT
ISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQLVEENH
LRWDSLGEFLALAVSLEDIGDKTGNQKVKILARTLDEATGKLLDNNKSPSPRTGELDNRG
SQFYLAMYWAEALAAQTEDKELQAHFAPLAKTLIENEKKIAEELKAVQGKPADIGGYFVA
DPEKCKAVMRPSATFNAALKAARI
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagagaaatcaaagattatttacacgctgacagatgaagcgccacttttggcg
acttgcgcatttctgccaattattcgtacttttacagcacctgctggcgtagagattgtg
aagagcgacatttctgttgctgctcgtattttggctgagttcaatgattgtcttactcct
gagcagcaagttttggataacttgggcgcgctcggcaagatgactttgttgcctgacata
aatattattaagttgccaaacattagcgcttctgttccccagttgctcgcagcaattaaa
gagttgcagtccaagggctataagatcccagatttccctgaagatccgaaaacggatgaa
gaaaaatctattcgtacgcgctactccaaatgcttgggaagctcagttaacccggtgtta
cgtgaaggcaactccgatcgccgtgcgccacccgctgtaaagcgttacgctcgcaaaaac
ccgcactctatgggtgagtggagccaagcttcccgtacgcacgtatcccatatgcatggc
ggcgacttctactctagcgagaagtcaatgactatgactaaggcttgtgatgtgaagatg
gatttggtaaccaagagcggcaagacaattgttcttaagccaaaagtttctttgctggct
ggcgaaattatcgacagcatgtatatgagcaaaaaagcactttgtgagttctatgagaaa
gaaatcgaagatgcttataagactggcatgatgttgtccttgcacgtgaaagccaccatg
atgaaggtctcacacccaattgtgtttggtcatgcagtaaagatcttctacaaagacgct
tttgaaaaacacgcgaagttgtttgaagagttgagcgtaaatgttaacaacggtatgagc
agtctgtatgaaaagattaagactttgccagaatcaaagcgcgaagaaatcattcaagac
ttacatgcttgctatgagcatcgtccagcattggcaatggttgattccgctaaaggtatt
accaaccttcattctccaagcgatgtgattgtggatgcctctatgcctgcgatgatttgt
gttggtggcaagatgtggggtgcggacggtcgcttgcatgacactaaggctgtgattcca
gaaagtacctttgcccgtatctatcaagaaatgattaatttctgtaagacacacggcaat
tttgatccaaaaaccatgggcacagtgcctaacgtaggtttgatggctcaacaggctgaa
gagtatggctcacatgacaaaacatttgaaattcctgaggctggtgtagcgcgtatcgtt
gctgatgatggcactgtattgcttgagcaaaatgtagaagagggcgatatctggcgtatg
tgtcaggttaaagatgcgccaattcgtgactgggtcaaattggcagtaaaccgtgcacgt
ctttccaatactccagcagtattctggctcgatgagtaccgtccgcacgaagccgagttg
atcaagaaggtaaatacctatctcaaagattacgatcttacaggcgtagatattcagatc
atgtctcagactcgtgcaatgcgttacaccttagagcgtgtaattcgtggtaaagatact
atctccgtaacaggaaatattttgcgtgattacctcaccgatttgttcccaattatggaa
ttgggaactagtgccaagatgttatctattgtgcctttgatggcaggtggcggcttgttc
gagactggtgcaggcggttctgctccaaagcatgttcaacagttggtagaagaaaaccac
ttacgttgggattcacttggtgagttcttggctttagcagtttctctcgaggacatcggc
gataagactggtaatcaaaaagtgaagatcttggcgcgtacattggatgaggcgacaggc
aagttgttggataacaataagtcgccttcaccacgtactggcgagttagataaccgcggt
agtcagttctacttggcaatgtattgggctgaagcattggctgctcaaaccgaagacaaa
gaattgcaagcgcactttgcgcctttggcaaaaactttgattgaaaatgaaaagaaaatt
gctgaagagcttaaggcggtgcaaggtaaaccggcggatatcggcggttattttgttgct
gatcctgaaaagtgcaaggccgttatgcgtcctagcgcaactttcaatgcggccctgaaa
gcggcaagaatttaa

DBGET integrated database retrieval system