KEGG   Polynucleobacter necessarius: Pnec_1403Help
Entry
Pnec_1403         CDS       T00683                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pnec_1403
Enzymes [BR:pne01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Pnec_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like DAO AlaDh_PNT_C FMO-like Thioredoxin_9 Thioredoxin_4 FAD_binding_3 NAD_binding_9 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ACB44505
UniProt: B1XVX8
LinkDB All DBs
Position
1201038..1202615
Genome map
AA seq 525 aa AA seqDB search
MLDTNIKSQLKVYFEKIVSPIALVASLNDSDSSKQMLELLNEVAEQSDKITVKTDGKAAR
TPSFTVGKVDQEARITFAGLPMGHEMTSFILAILQASGYPAKVEQEIIERITNLEGKRSF
QTFISLPCHNCPDVVRALNLMAALNPNITHEMVDGALYQELVDQFQIMAVPTVILNGEVF
GQGRMSVEEIVAKLDNSSPKEEAAKLSAKDPFGVLVIGGAPAGSAAAIYAARKGIRTGIV
AERFGGQVMDTMGIENFISVKETEGPKLVQALEQHVKSYAVDIMNLQRANALRKTAGGVE
VELANGVALTSKSVILSTGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVSHVTLIEFDSKLRADAVLQKKMASMPNVTVIMSALTKEVLGADGKV
SGLRYQDRTNNTEHAIELEGIFVQIGLLPNTDWLKGTIDLSKHGEVIVDAKGETSLPGVF
AAGDCTTVPYKQIIIAMGEGAKASLGAFDYLIRSSVVEPEEAVAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataccaacatcaaatctcaattaaaagtatattttgaaaagattgttagtccc
atcgctctcgttgcaagcctaaatgacagcgacagctccaagcaaatgcttgagctttta
aacgaagtagctgagcaatccgataagatcactgttaaaacagatggcaaggctgcccgt
actcctagctttactgttggcaaagtagatcaggaggcgcgcattactttcgccggccta
ccaatgggtcatgaaatgacttctttcattctggctattttgcaagcaagtggttatccg
gcaaaagtagagcaagaaataatagaacgcattaccaatctagaaggcaagcgaagcttc
caaacatttatttccttgccatgccataactgcccagatgttgtacgggcgctgaatttg
atggcagctctaaacccaaatatcactcacgagatggttgatggcgcactttaccaagag
ctagtagatcaattccaaatcatggcagtcccaacagtcatcctcaatggcgaggtattt
ggtcaaggccgcatgagtgttgaagaaattgttgccaaactagataactcaagccccaaa
gaagaagctgcaaaactgtctgccaaagatccgtttggtgttttggtgattggtggcgct
cctgcgggctccgctgcagctatctatgcagcacgtaaaggcattcgcaccggcattgtg
gctgagcgatttggcggtcaagtgatggacaccatgggcattgaaaactttatctccgtt
aaagagaccgaggggcctaagttagtccaagcacttgagcagcacgtgaagagctatgca
gtcgatattatgaatttgcaacgtgcaaacgcattacgaaaaacagccggtggtgttgag
gtggagttagccaatggcgtagctctcaccagcaagtctgtgattttgagtactggtgct
cgctggagagagatgaatgttccaggcgagcaagagtatcgcggcaaaggggtggcctac
tgccctcattgcgatggtccgctatttaaaggcaaacgagttgcagtgattggtggcgga
aactctggcgtagaggccgcaattgatttggcgggcattgtgagccacgtcactctgatt
gagtttgatagcaaactgcgtgccgatgcagtgttgcaaaagaaaatggccagtatgcca
aacgtcaccgtcatcatgagtgcactcactaaagaagtattgggtgcagacggcaaggtc
agcggcctacgctatcaagaccgtacgaataatactgagcatgcgattgaacttgaaggg
atctttgtgcaaattgggttattgccaaacaccgactggctcaaaggaactatcgactta
tccaagcacggtgaagttattgtcgatgcaaaaggagaaacctctttgcccggggtattt
gcagctggagattgcactaccgttccctacaagcaaatcattattgcaatgggcgaaggc
gctaaagcttcactcggcgcatttgactacctgattcgctcatccgttgtcgagcctgag
gaagcagttgctgcttaa

DBGET integrated database retrieval system