KEGG   Pseudoalteromonas nigrifaciens: PNIG_a2970Help
Entry
PNIG_a2970        CDS       T05271                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
png  Pseudoalteromonas nigrifaciens
Pathway
png00250  Alanine, aspartate and glutamate metabolism
png00410  beta-Alanine metabolism
png00430  Taurine and hypotaurine metabolism
png00650  Butanoate metabolism
png01100  Metabolic pathways
png01110  Biosynthesis of secondary metabolites
png01120  Microbial metabolism in diverse environments
png02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:png00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PNIG_a2970 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PNIG_a2970 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PNIG_a2970 (gadB)
   00430 Taurine and hypotaurine metabolism
    PNIG_a2970 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PNIG_a2970 (gadB)
Enzymes [BR:png01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PNIG_a2970 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ASM54929
UniProt: A0A221IMK5
LinkDB All DBs
Position
I:complement(2726928..2728553)
Genome map
AA seq 541 aa AA seqDB search
MDQKRFAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAMIPEDPTFVSAYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGQQDEFYAKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKPDGDFRGIGAQGLIAGMLHYGYKGLAILISERGHYSLGKAADLLGIGRENL
VGIKTCENNKVDVNAMREKALELEAQGIKVMAIIGVAGTTETGNIDPLEAMADLAQDINC
HFHVDAAWGGATLLSNTHRHLLKGVERADSITIDAHKQMYVPMGAGLVLFKDPTATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKAHYFANLI
KADEDFELISEPELCLLTYRYVPKQIKQAIADADPQTRIDIFASLNRFTASMQKRQRESG
RSFVSRTRLTPTQYDNQPTVVFRVVLANPLTSGVILKEILAEQKELAKTDPVFKKYLSKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttttgccgtcgcctctaaagaaagccttaagcgtatatttactgta
cctgaagcgccagactcaactttaagcaaaatagagcttgaaatatcgagtaatttagca
ggttttttaaacgaaaacattgcggcaattgaaaaaccattacacgaaattgaaaaagac
tttcagtcggcgatgatcccagaggatccaacgtttgtatctgcttatgcgcaagatata
atggagcagctggttgcacactctgtgcataccgcagcgcctagctttattggccatatg
acttcagctttacctcattttttactaccactgtcaaagctaatggtagggctaaatcaa
aacctagtaaaaatagaaacctctaaagcttttaccccacttgagcgccaagtgcttgga
atgatgcaccatttagcgtacgggcagcaagacgagttttatgctaaatggatgcacagt
gcaaaaacatcattaggtgcattttgctcaggcggtactgtagccaatattacggcgtta
tggattgcgcgaaatcgcttattaaaacctgatggcgattttaggggaataggcgcacaa
ggcttaattgccggtatgctgcattacggctataaaggcttagctattttaatttctgag
cgaggccattattcgttaggtaaagcggctgatttattaggaattggtcgtgaaaactta
gtgggtattaaaacatgcgaaaacaataaagttgatgttaatgccatgcgcgaaaaagcc
ttagagcttgaagcgcaaggtattaaagtaatggccattattggagtagcgggtaccaca
gaaaccggtaatatcgatccccttgaagcgatggctgatttagcacaagacattaattgc
cactttcatgttgacgctgcatggggcggggcaactttgttatctaatacccatcgccat
ttactcaaaggtgttgagcgcgcagactcaattaccattgatgcacacaaacaaatgtat
gttcctatgggagctgggttggtgttgtttaaagatccaaccgctaccgatgcaattgaa
catcatgcagagtatattttacgtaaaggctcaaaagatttaggtagccatacacttgag
ggcagccgcccaggtatggcaatgttagtacatgcttgcttacgtgtaattggccgtaaa
ggctacgaaatgctaatcgatcgtagtattaaaaaagcccattactttgctaatttaatt
aaagcagatgaagattttgagctgatctcagagccagagctgtgcttattaacgtatcgt
tatgtgcctaagcaaataaagcaggcaattgcagatgctgatccacaaacacggattgat
atttttgcctcacttaatcgctttactgcaagtatgcaaaaacggcaacgtgaatcaggg
cgatcatttgtatcacgtacgcgtttaacgcctactcaatacgataatcagcccaccgtg
gtatttagggtagtacttgctaacccacttacatcaggcgttattttaaaagaaatttta
gcagaacaaaaagagttggctaaaacagatccggtatttaaaaagtatttaagcaagtat
atgtaa

DBGET integrated database retrieval system