KEGG   Pseudoalteromonas nigrifaciens: PNIG_a3192Help
Entry
PNIG_a3192        CDS       T05271                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
png  Pseudoalteromonas nigrifaciens
Pathway
png00473  D-Alanine metabolism
png00550  Peptidoglycan biosynthesis
png01100  Metabolic pathways
png01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:png00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PNIG_a3192 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PNIG_a3192 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PNIG_a3192 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:png01011]
    PNIG_a3192 (ddl)
Enzymes [BR:png01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PNIG_a3192 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:png01011]
 Precursor biosynthesis
  Amino acid ligase
   PNIG_a3192 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 RimK ATP-grasp_4 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ASM55117
UniProt: A0A379H7T9
LinkDB All DBs
Position
I:complement(2925075..2925995)
Genome map
AA seq 306 aa AA seqDB search
MTQLNTQFGKVAVLLGGNSAEREVSLRSGQAVLNALQNHGINAIAFDPKERPLWELNELA
IDRVFIALHGRGGEDGTVQGALEFMNLPYTGSNVLGSALAMDKVRCKHLFKSAGLSTAPY
TVVDAKKGFDAAAIMQQFKKVMVKPSHEGSSIGMAQASTPQELEDALSNAFKFDSQVLVE
QWISGREFTITVLGDEVLPVIEMTTPNGFYDYQAKYQATTTQYHCPADLSPADTEHLQAM
ALDAFDLVGASGWGRVDAMQDQQGDFYLLEVNTVPGMTEKSLVPMAAKAHGASFEQLVVR
ILEQTL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacacagttaaatacgcagtttggtaaagtagcggtgctgttagggggtaactcagca
gagcgtgaagtgtcattaagatcaggacaagcggtattaaatgcattgcaaaatcatggc
ataaacgccattgcctttgacccaaaagagcgcccgttatgggagctaaatgagttagca
attgatagagtgttcattgcactgcatggtcgtggtggcgaagacggtacagtgcaaggt
gcgcttgaatttatgaacctgccgtatactggcagtaacgtactaggctcagcgctggct
atggataaagtgcgttgtaagcatttatttaaatcggcagggttaagtaccgctccttat
accgtggttgatgccaaaaaaggctttgatgcagcggcaataatgcagcaatttaaaaaa
gtgatggtaaagccgtcacacgaaggctcaagtattggtatggcacaagcaagcacgcca
caagagcttgaagatgcactgagtaatgcgtttaagtttgatagccaagtgctagttgaa
cagtggatcagtggccgcgaatttaccataacggtattaggcgatgaagtgttgccagta
atcgaaatgacaacccccaatggtttttatgattaccaagctaaatatcaagcaaccacc
acgcagtatcattgcccggcagatttatcgcctgcagataccgagcacttacaagcaatg
gcactcgatgcatttgatttagtaggtgctagcggctggggacgcgtagatgcaatgcaa
gatcagcaaggtgatttttacttattagaagtaaatacagtacccggtatgaccgaaaag
tcgcttgtacctatggcggcaaaagcacatggtgcaagttttgagcaattagttgttcgc
attttggagcaaacactttaa

DBGET integrated database retrieval system