KEGG   Pseudoalteromonas nigrifaciens: PNIG_b0386Help
Entry
PNIG_b0386        CDS       T05271                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
png  Pseudoalteromonas nigrifaciens
Brite
KEGG Orthology (KO) [BR:png00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PNIG_b0386 (ahpF)
Enzymes [BR:png01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PNIG_b0386 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored NAD_binding_9 FAD_binding_3 NAD_binding_8 Thi4 K_oxygenase AlaDh_PNT_C Glutaredoxin Lycopene_cycl Thioredoxin_9 Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ASM55984
UniProt: A0A379I3K8
LinkDB All DBs
Position
II:352443..354014
Genome map
AA seq 523 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSTEVASLANDLASLSDKFTVINNPDTSA
RRPSMVVHSPIKNTHITFAGVPMGHEFTSLVLALLHTGGHASKAKAEDIEQIKSLDQALN
FEVYISLSCQTCPQVVQALNTMAATNNKIKATMIDGALFQGEVEERNILAVPAVYLNGEP
FSQGALSLTDILNKVDSKGAMRQAESLSKKEKFDVLVIGGGPAGASAAIYSARKGLNTGI
VADRFGGQVADTLAIENFISIKATEGPKLVAQLEEHVKEYDVDVMHNQRAARLSRNNNGY
EITLENGAVLSAKSLVLATGARWREMNVTGEQQYRGHGVAYCPHCDGPLFKGKPVAVIGG
GNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKASSMANITIIKSAQTTEVLGDGKK
VTGLTYTDRVSGDSKQLTLAGIFVQIGLIPNTEWLKDSELELSKFGEILIDAKGATSLPG
VYGAGDATNTPFKQIIIAMGSGATASLGAFDYLIRHSDETEQA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaacataaaaaatcaattaaaaagccattttgaatcgcttactcaacct
gttgagctgcttatcgccttggacgacagcaaaaaatcaacagaagtagcaagcttagca
aatgatttagcctcactaagcgataaatttacggtaataaacaacccagacacaagcgcg
cgtcgtccgtcaatggttgtacattcacctattaaaaacacccatattacgtttgcgggt
gtacctatgggccacgaattcactagtttagtgttagcgctattgcacactggcggacat
gccagtaaagcaaaagccgaggacattgaacaaataaagtcgctcgaccaagcgcttaat
tttgaagtgtatataagcttaagttgtcaaacctgcccacaagtagtgcaggctttaaat
acaatggcagcaacgaataataaaattaaagccaccatgatagatggcgcgttatttcaa
ggcgaagtagaagagcgcaacattttagctgtaccggctgtttatttaaatggcgaacca
tttagccaaggtgcactaagcctaaccgacatactcaataaagtagatagcaaaggtgca
atgcgccaagctgagtcgttaagtaaaaaagaaaagtttgacgtgttagttattggtggt
gggcctgcgggtgcatcggctgctatttactcagcacgaaaagggttaaacaccggtatt
gttgcagataggtttggcggacaagtagccgatactttagcaatcgaaaactttatttcg
attaaagccaccgaagggccaaaactggtagcgcaactagaagagcacgtaaaagaatac
gatgtagatgtaatgcataatcaacgcgcagctaggcttagtcgcaataataatggttac
gaaattactctagaaaacggcgcggtactgagtgctaagtcgctggtactggcaacaggt
gcacgctggcgcgaaatgaacgtgactggcgagcaacaatatcgtggccacggtgtggca
tattgcccacattgcgatgggcccttatttaaaggcaaaccagttgcggtaattggtggc
ggtaattcaggtatagaagccgcgattgatttagccaatattgtagagcatgtaacggta
cttgaatttgccgatacattacgtgccgacgaagtacttattcgcaaagctagcagtatg
gctaatattactattattaaaagtgcacaaacaaccgaagtactcggcgatggcaaaaaa
gtaaccggtttaacttacaccgaccgcgtaagtggcgacagtaagcaactcactcttgcg
ggcatatttgtacaaattggtttaataccaaatacagaatggctaaaagacagcgagctt
gaactgagcaaatttggtgagattttaattgatgccaaaggcgcaacatcactcccaggc
gtttatggtgcgggggatgcaaccaatacgccatttaagcaaataataattgctatgggc
agtggtgcaacagccagtttaggtgcgtttgattacttaattcgccacagcgatgaaaca
gagcaagcttaa

DBGET integrated database retrieval system