KEGG   Candidatus Protochlamydia naegleriophila: PNK_0622Help
Entry
PNK_0622          CDS       T04212                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
pnl  Candidatus Protochlamydia naegleriophila
Pathway
pnl00471  D-Glutamine and D-glutamate metabolism
pnl00473  D-Alanine metabolism
pnl00550  Peptidoglycan biosynthesis
pnl01100  Metabolic pathways
pnl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pnl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PNK_0622 (murC)
   00473 D-Alanine metabolism
    PNK_0622 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PNK_0622 (murC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PNK_0622 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pnl01011]
    PNK_0622 (murC)
Enzymes [BR:pnl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PNK_0622 (murC)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     PNK_0622 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:pnl01011]
 Precursor biosynthesis
  Amino acid ligase
   PNK_0622 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_C Mur_ligase_M
Motif
Other DBs
NCBI-ProteinID: CUI16249
UniProt: A0A0U5J838
LinkDB All DBs
Position
cPNK:746275..747666
Genome map
AA seq 463 aa AA seqDB search
MSDNYHFIGIGGIGMSGLARILLHQNIAVTGSDIAFNYTIDGLIKAGATIHKGQAASNIT
AGTTVIYSSDIKADNPEYNAAVSLQCPLLHRSDLLAHLIKDKCSLAVAGTHGKTTTSSLL
ATVLWEAGLDPSFAVGGMLPQFQTNSHWGQSNLFAFEADESDGSFLKYAPFGAIVTNIDN
DHLSAYNGSTAVLIEAFRTFISQVKSLEHLFWCGDDAHLMHLNVGGQSYGFGKYCDWRIS
NVQQKDFQLFFDLEGPGKVYSEIALNLSGVHNALNAAAVFALAMALKVPEESIRNSFKNF
KGVLRRCERKGEFDGTLFIDDYAHHPTEILTTLQGIRNAIQSKRLIAVFQPHRYSRTQDC
LGQYGQIFASADEVIVTDIYGAGEAPISGLSHEQIIQEIRQASAASVQYVPRPALGHKLS
QFVQPQDVVVTLGAGDITKVAGEALALLENSRFTLDGQPSLSY
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaattatcattttattggaattggtggcattggcatgagcggcctggctcgc
attctgttgcatcaaaatattgcggtcacgggaagtgatattgcttttaattacacgatt
gacgggttgatcaaggcgggagctacgatccataaagggcaagcggcttctaatattaca
gctggcacaacggttatttatagcagcgatatcaaagcggataatccagaatataacgct
gctgtatccttgcaatgcccgcttcttcatcgctccgatttattggcccatttaatcaaa
gataaatgctcgcttgctgttgcaggcacacacggtaaaacaacgacctcttctttgctc
gcgaccgtactttgggaggctgggctagatccttcatttgctgttgggggcatgcttcct
caatttcaaactaattctcattggggccagagtaatctttttgcttttgaagctgatgaa
agcgatgggagctttttgaagtacgctccttttggagccatcgtgacaaatattgataat
gaccaccttagtgcatataacggatcaacagctgtattgatcgaagcctttcgcaccttt
atctctcaagtaaagtcgctagagcatttgttctggtgcggcgatgatgctcacttaatg
catttaaacgtaggagggcaatcgtacgggttcggcaagtactgcgattggagaatctcc
aacgttcagcaaaaagattttcagctgttttttgatctagaggggcctggaaaagtgtat
tccgagattgcattgaatctgagtggagtgcacaatgcactaaatgctgcggctgttttt
gctttggctatggctctcaaggtgcctgaagagtctattcgaaacagctttaaaaatttt
aagggtgtgcttagaaggtgcgagagaaagggggagtttgatggaactctcttcatcgat
gactatgcccatcatccgactgagatcttaacgacattgcaaggcattcgcaatgcaatt
caatccaagcgtttaattgcggtttttcagccccatcgctactcgcgcacacaagattgc
cttgggcagtatgggcagatttttgcatcggcagatgaggtcattgtgaccgacatttac
ggtgcaggcgaagctcccatttcaggcttatcgcatgagcaaatcattcaggaaatcagg
caggccagtgcagcctctgtgcaatatgtaccccgacctgctttagggcataaactgagc
caatttgtgcagcctcaagatgttgttgtcacgttaggtgcgggtgatatcacaaaggtg
gcaggggaggcgctggctttactggaaaatagccgcttcactttagatggccagccgagt
ttaagctactag

DBGET integrated database retrieval system