KEGG   Protochlamydia naegleriophila: PNK_2195Help
Entry
PNK_2195          CDS       T04212                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pnl  Protochlamydia naegleriophila
Pathway
pnl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pnl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PNK_2195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pnl03400]
    PNK_2195
Enzymes [BR:pnl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PNK_2195
DNA repair and recombination proteins [BR:pnl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PNK_2195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme GH3
Motif
Other DBs
NCBI-ProteinID: CUI17796
UniProt: A0A0U5JG24
LinkDB All DBs
Position
cPNK:2563342..2565213
Genome map
AA seq 623 aa AA seqDB search
MPEAIKPMLATLVDEPFDNKDWIFEIKWDGYRTLAYIQKGDVSLLSRNNQSFNTRFSSLV
KALRTIEMDAVLDGEIVVLNEDKKPSFQLMQNYQRNQKGMLVYYVFDLLYLQGYDLRDMP
LLQRKELLKKLLPKNSQILFCDHVTGKGKAFFQSVLKQGFEGIIAKNAQSVYASGRSRNW
LKIKTHQRQEAIICGFTAPRKSRKHFGSLILGVYDGGKLTYVGHTGSGFGEEKLKELYER
LQKLAQDKCPFENVPKTNMNPTWAKPKLVCEISFAEWTNDKIMRQAIFIGIREDKSPTEV
AFEKEVPTKEVLAESEDHPKVPSLKKKSSPKPLLHLKLTHLDKLYWPQEGYTKGDLIEYY
REVSSLILPYLKDRPETLRRYPNGIGETSFYQKELFHAPSWIRTEPIHHEERKIRYLVID
DEESLLYAVNLGCIDLNPFNSRVQSLHQPDYLIIDLDPEDISFDHVLEVAQGVHHVLESW
NVPNLCKTSGATGLHIYIPLGARYNYDEARQFGNLIAHVVHQALPKITSIERTPRNRQKK
VYLDYLQNRFGQTVAAPYSVRPKPYAPVSTPLKWSEVKAGLQPTDFTIKNAVERFKKLGD
LFQPILGKGIDLKKILEKVATGL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagcgattaaacctatgctggccaccctagtcgatgagccttttgacaataaa
gattggatttttgaaattaaatgggatggttataggacgcttgcctacattcaaaaggga
gacgtttcactcttatcgcgcaacaaccaatcctttaatacccgcttctcctcgcttgtc
aaggcattaagaaccatcgaaatggatgccgttctggatggcgagatcgtcgtattaaac
gaagataaaaagccaagctttcagctcatgcaaaattaccagcgcaatcaaaaaggaatg
ctcgtctattacgtattcgatctcctctatctgcaaggctatgacttgcgagatatgccc
ctcctccagagaaaagagctgcttaaaaagcttctccccaaaaattctcagatccttttt
tgcgatcatgtcacaggaaaaggcaaagcgtttttccaatcggtattgaagcaaggcttt
gaaggcatcattgccaaaaatgcgcaaagtgtttatgcatcgggacgcagccgcaattgg
ctcaaaatcaagacacatcaacgccaagaagctatcatctgcggttttacggccccaaga
aagtcgcgcaagcattttgggtctctcatcttaggtgtctatgacggaggcaagctaacg
tacgttggccacacgggcagcggttttggagaagagaagttaaaagagctctatgaacgc
cttcaaaaacttgcacaagacaagtgcccttttgaaaacgttcctaaaacgaacatgaat
ccaacttgggccaagcccaaactcgtctgtgaaataagctttgccgaatggacaaacgac
aagatcatgcgtcaagctatttttattggcattagagaagataaaagccctacagaagtc
gcattcgaaaaggaagtcccgacaaaagaggtactagcggagtccgaggaccatccaaaa
gtcccttcgttaaagaagaaaagcagtcctaagccgctactccatctcaaattaacccac
ctcgacaaactctattggcctcaagagggatacaccaagggagatttaattgagtattac
cgcgaggtttcttccctcattttaccttatctaaaagaccgccccgaaaccttgcggcgc
tatccaaatgggatcggagaaacaagtttttatcaaaaagaactgttccatgctccttct
tggatacgaactgaacccattcaccacgaagagcgcaagatccgctaccttgtcatcgat
gatgaagagagcctcttatacgcggtcaatttaggatgcattgatttaaatccctttaat
tctcgcgtacaatcgctgcatcaaccagactacctgattatcgatctggatccagaagat
atttctttcgatcacgttttggaagtagcccaaggtgtacatcacgtcttggagagctgg
aatgttcccaacctttgcaaaacgtctggcgcaacgggccttcatatctacattccatta
ggagcccgctataattacgacgaagcgcgccaatttggcaatttgattgctcacgttgtc
caccaagcgctgccaaaaatcacttccattgagcgcactccgcgcaacaggcaaaaaaaa
gtttatttagactacttgcagaaccgcttcggccaaacagttgccgctccttactctgta
agaccaaaaccctatgcccctgtctctacccctttaaaatggagcgaagtcaaagccggt
ttacaaccgacagacttcaccatcaaaaatgccgtcgaacgattcaagaagctgggtgat
ttatttcaaccgattcttggcaaaggaatcgatcttaaaaagatcctggaaaaggttgca
accggtctttaa

DBGET integrated database retrieval system