KEGG   Parastagonospora nodorum: SNOG_01761Help
Entry
SNOG_01761        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K11274  chromosome transmission fidelity protein 4
Organism
pno  Parastagonospora nodorum
Brite
KEGG Orthology (KO) [BR:pno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pno03036]
    SNOG_01761
Chromosome and associated proteins [BR:pno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    SNOG_01761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid ANAPC4_WD40 WD40 PD40 Coatomer_WDAD TFIIIC_delta MAGE DNA_pol_alpha_N Frtz
Motif
Other DBs
NCBI-GeneID: 5969237
NCBI-ProteinID: XP_001792392
UniProt: Q0V2K3
LinkDB All DBs
Position
Unknown
AA seq 841 aa AA seqDB search
MQGRQAHAPGATYLAYTPNGKKLITAGVDNYCRVFSTGSDDEPVTVDNCQEDNTTIVAGS
GFFITGSEDGTVSKYTLDGNKFEEILDRATLPIRDVALSPDGQWIAVASERTLRDQPRAV
KHVSFDKTGKQLAVSCADGNIYMYSLEEDQPEMVKKIDGMIKSLETDAESSSRVLWHPDG
RAFATPTALRDVQVMSTSDWERQRVFKTGHSADITAAAWSPNGALLATTSSDLNLSLWDT
KTQKMLKKFDDVKATILAMAWHPTENILSYTNNEGELFIHTGFVPEDQLPLLQKPTVSAP
FFHDPAGGRAGVAPAPDKVANDDLLGPDFRDDEADEDGDEEMNDFVVDDDGAGYAPALNG
HGKRPNVHIANGIEPSSKRRATSSAMFRPQVHEPFQPGATPWRGNRRLLCCSLTGYVETV
SQEGRHHTVSVKFYDEHTFRNFHFTDIFLYDKACLNENGTLFACQPNSTGDGNPGMIYYR
PHETWTTRTEWRTNLPAGESVTAIALSDSYVCVTTSANYVRIFSLFGLPIRVYRQKSSPA
VTCAAWRDYILTIGNGPIQSDLSTQLLYTIENIKHDTIYQDSDILALPPNTQLTSVFFSA
EGDPYIYDSSGVLLTCLGWRTAGQARWVPMLDTKCLSRLASGGKEESYWPVGVASDSSSA
TDIKFHCMIIKGKETYPSAPVPHLSEFGFEIPLSSAVEKKKNAPEEEGSDDEDGSAAAKK
SEAKQQDHEQAFILSSTLHSQLSSTIQATRPSPAQRQDLTNLEVAIDRALLQLLGLECLA
GEDHGMKALEIVSLMRDANGKMLDLAGKVAARYGRDVLGEKIRELAEKKAMERVEDIEDD
Y
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaagacaggcccatgcccctggcgcaacttacctcgcatacacaccgaacgga
aagaagctcattacagccggagttgacaactactgccgcgtgttcagtaccggatccgac
gacgagcctgttacagtagacaactgccaagaagacaatacaacgatagtagctggtagc
ggcttcttcatcacgggatccgaggatggtacagtgagcaagtacacactcgacgggaat
aaattcgaggaaatattggacagagccactctgcccatacgagatgtggcactgagtcca
gacggacagtggattgctgtcgcgagcgaacggaccttacgcgaccagcctcgagctgtg
aaacatgtgtccttcgataagacgggcaagcagctcgctgtttcctgcgctgacggcaac
atctacatgtactctctggaggaagatcaacctgaaatggtcaagaagattgacggcatg
atcaagagtctggaaacagacgcggaatctagctcgagggtgctatggcatccggacggc
agagcgttcgctacaccaacagcgctgcgggatgtccaggtcatgtccacaagcgactgg
gaacggcaaagggtcttcaagactggccatagtgcagacattacagcagccgcttggtcg
ccgaatggtgctcttctggcaacaacctcaagtgacttgaacctcagtctctgggacacc
aagacacagaagatgctaaagaagttcgacgatgtgaaggctaccattcttgcaatggca
tggcatccaacagagaatatcttgtcctacaccaacaacgaaggcgaactgtttatccac
acaggctttgtgcccgaagaccagctaccgctgctacaaaagcctaccgtatcagcaccc
ttcttccacgaccctgcaggtggccgtgctggagttgccccggcaccagataaagttgca
aatgacgatttgctcggccctgacttcagggacgacgaagcggatgaagacggcgacgaa
gagatgaacgattttgtagttgacgacgatggtgctggctatgcacctgctctgaatggc
catggcaagcgtccgaatgtccacattgccaacggcatagagccctcctccaaacggcga
gctacaagtagtgccatgttccgcccacaagtccatgagcccttccagcccggtgcaaca
ccatggcgaggcaatcgaagactcctttgctgctctttaactggatacgttgaaactgtc
tcgcaagaaggccgacatcacactgtgtccgtcaagttctacgacgaacacactttccgc
aacttccactttactgacatcttcctttacgataaagcgtgtcttaacgaaaacggcaca
ctcttcgcctgccaaccgaacagcactggcgacggaaacccaggcatgatctactaccga
ccacacgagacctggactacccgaacagagtggcgcacgaacctaccagctggtgagtcc
gtgactgccatcgctctctcagactcctacgtctgcgtcacaacctccgccaactacgtc
cgcatcttctccctcttcggcctccccatccgcgtctaccgccaaaagtccagcccagcc
gtaacctgcgcagcatggcgcgactacatcctcaccatcggcaacggacccattcaatcc
gacctcagtacgcagctcctctacaccatcgaaaacatcaaacacgacaccatctaccaa
gactcggacattctcgccctcccacccaatacccagctcacatccgtcttcttctcagcc
gaaggcgatccctacatctacgactcttcgggtgtcctcctaacctgccttggctggcgc
accgccggccaggcccgctgggtccccatgctcgacacaaagtgcctcagccgtcttgcc
tcgggaggcaaagaagaatcatactggcccgtgggcgtcgcgtccgactcgagttcggcc
acagacatcaaattccactgcatgatcatcaagggcaaagagacatacccctccgcgccc
gtcccgcacctgtctgaattcggcttcgaaatcccgctcagcagcgccgtcgaaaagaag
aagaacgcgcccgaggaggaagggagcgatgatgaagacggcagcgctgctgcgaagaag
agcgaggcgaaacagcaggatcacgaacaggctttcatcctgtcgtctaccttgcactcg
caactctcttcgaccatccaagcgactcgtccctcgcccgcgcagcgccaggacctgacg
aacttggaagtcgcgattgatcgggcgctgctgcaattgctgggcttggagtgtctggcc
ggcgaggatcatggcatgaaggcgttggagattgtcagtttgatgagggatgcgaatggc
aagatgctggatttagcgggcaaggtcgcggcgaggtatgggagggatgtgctgggtgag
aagataagggagctggcggagaagaaggccatggagagggtcgaggatattgaggatgat
tattag

DBGET integrated database retrieval system