KEGG   Parastagonospora nodorum: SNOG_02205Help
Entry
SNOG_02205        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pno  Parastagonospora nodorum
Pathway
pno00250  Alanine, aspartate and glutamate metabolism
pno00410  beta-Alanine metabolism
pno00430  Taurine and hypotaurine metabolism
pno00650  Butanoate metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
Module
pno_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SNOG_02205
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SNOG_02205
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SNOG_02205
   00430 Taurine and hypotaurine metabolism
    SNOG_02205
Enzymes [BR:pno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SNOG_02205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 5969671
NCBI-ProteinID: XP_001792821
UniProt: Q0V1A9
LinkDB All DBs
Position
Unknown
AA seq 526 aa AA seqDB search
MVHINRVATTKEVNDEKSQFESAPESKINLHPDDDADDYTATVYGSRYAEEDLPRHEMPD
KEMPPSVAYRLIKDDLTLDGTPTLNLASFVTTYMEEEAEKLMVDAFSKNFIDYEEYPVSA
DIQNRCVSMIARLFNAPSEDDSNTIGTSTIGSSEAIMLGVLAMKKLWQNKRKAEGKPFDK
PNMIMNSAVQVCWEKACRYFDVEERYVYCTTERYVIDPKECVDLCDENTIGICAILGTTY
TGEYEDIKGINDLLIERNIEVDIHVDAASGGFVAPFVNPGLLWDFRLPKVTSINVSGHKY
GLVYPGVGWVVWRDPKYLPQELVFNINYLGADQASFTLNFSRGASQIIGQYYQLIRLGKR
GYRRIMLNLTRTADYLSANLENMGFIIMSQRGGEGLPLVAARIDEDLGKQYDEFAVAHQL
RERGWVVPAYTMAPHSEQMKMLRVVVREDFTKSRCDALIADFKLALQTLDSLDAKKLQEH
KEHQFAMRRRSTLTTPIFSKGKKANNPFVDEDHSLQGKTGKTHAVC
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacatcaatcgtgtagccaccacgaaggaggtcaatgacgagaagtcccagttt
gaatcggctcctgagtccaagatcaatctccacccagatgacgatgcggacgactacacg
gcaacggtgtacggtagccgatatgctgaagaagacctgccacgccatgagatgcccgac
aaggagatgccgccttctgtcgcgtaccgcctcatcaaagatgacctcacgctcgatggc
acgccgacgctcaacctcgcgtcgtttgttacaacttatatggaagaagaagccgagaag
ctcatggtagatgccttctccaagaacttcatcgactacgaggaataccccgtctccgca
gatatccagaaccgctgcgtctctatgattgcccgcctcttcaatgctccctccgaagac
gacagtaacactatcggtacctctacaatcggttcgtccgaggctatcatgctgggcgtg
ctagcaatgaagaagctatggcaaaataagcgcaaggcagagggcaagccattcgataag
cccaacatgatcatgaactcggcagttcaggtgtgctgggagaaggcgtgtcgctacttc
gacgtcgaggagcgatatgtatactgcactaccgagcgctatgtcatcgatcccaaggag
tgcgttgatctgtgtgacgagaacactatcggcatttgcgccatccttgggaccacctac
acgggcgaatacgaagacatcaagggcatcaacgatctcttgattgagcgtaacatcgag
gttgatatccatgtagacgctgcatctggtggtttcgtcgctcccttcgtcaaccctggt
cttctctgggacttccgccttcccaaggtcacgtcaatcaacgtctctggtcacaagtac
ggattagtgtaccctggagtaggctgggtcgtatggcgcgatcccaagtacctaccccag
gagcttgtcttcaacatcaactatcttggtgcggaccaggcatccttcacgctcaacttt
tcccgcggcgccagtcagattatcggacagtactaccaacttattcgcttaggcaagcgt
ggatacagacgcatcatgctgaacctcacgcgcacagccgactacctctcagcaaacctc
gaaaacatgggcttcatcatcatgagccagcgaggtggcgaaggcctgcccctcgtcgct
gcaagaattgacgaggatctcggaaagcagtacgacgaattcgccgttgcccaccaactg
cgcgagcgcggctgggttgttcctgcctacaccatggcgccgcactcggagcagatgaag
atgctgagagtagtcgtacgcgaggactttacaaagtcgaggtgtgacgcgctaattgcg
gatttcaaacttgcgctgcagacgctggattcgctggatgcgaagaagctgcaggagcat
aaggagcatcaatttgctatgcgccgccgctcgacgctcactacgccgatcttctcaaag
ggcaagaaggcgaacaatccgtttgtggatgaggaccatagcttgcaaggcaagacgggt
aagacacatgctgtgtgctag

DBGET integrated database retrieval system