KEGG   Parastagonospora nodorum: SNOG_06374Help
Entry
SNOG_06374        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SNOG_06374
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SNOG_06374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 5973626
NCBI-ProteinID: XP_001796747
UniProt: Q0UPE0
LinkDB All DBs
Position
Unknown
AA seq 230 aa AA seqDB search
MNTTLLRTSALRSAARATAPAVSRAGLAGTTFVRGKATLPDLSYDYGALEPAISGKIMEL
HHKNHHNTYVTSFNNFSEQIAEAKQKQDIAAQIALQPLINFHGGGHLNHTLFWENLAPTS
QGGGEPPTGALSKAINDSYGSLDAFKEKFNTALAGIQGSGWAWLVQDTQTGSVQIRTYAN
QDPVVGQFRPILGVDAWEHAYYLQYQNRKAEYFKAIWDVINWKAAEKRFK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccacactcctccgcacatctgccctgcgctctgccgccagggctaccgcaccc
gccgtctctcgagctggcctcgcaggcaccacattcgtccgcggaaaggccactcttccc
gacctttcatacgactacggcgccctcgagcccgccatctcgggcaaaatcatggaactc
caccacaagaaccaccacaacacctacgtaacctcgttcaacaacttcagcgagcaaatc
gccgaggccaagcagaagcaggacatcgccgcgcaaatcgcgctccagccattgatcaac
tttcacggcggcggccatctcaaccacaccctgttctgggagaacttggcgcccaccagc
cagggcggcggcgagcccccaacgggcgccctgagcaaggcgattaacgacagctacggc
agcttggacgcgttcaaggagaagttcaacaccgcgctggcgggcatccagggcagtggg
tgggcgtggttggtccaggatacccagacgggcagtgtgcagatcaggacgtacgcgaac
caggaccctgtagtggggcagttcaggccgattttgggtgttgatgcttgggagcatgcg
tactacctccagtaccagaaccgcaaggcggagtacttcaaggctatctgggacgtcatc
aattggaaggcggcggagaagcgcttcaagtga

DBGET integrated database retrieval system