KEGG   Parastagonospora nodorum: SNOG_06620Help
Entry
SNOG_06620        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pno  Parastagonospora nodorum
Pathway
pno00052  Galactose metabolism
pno00500  Starch and sucrose metabolism
pno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SNOG_06620
   00500 Starch and sucrose metabolism
    SNOG_06620
Enzymes [BR:pno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SNOG_06620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 5973865
NCBI-ProteinID: XP_001796986
UniProt: Q0UNP4
LinkDB All DBs
Position
Unknown
AA seq 919 aa AA seqDB search
MFNQLLLAIAAGAGLIAAAPTPQESPSALQARDADPNSCPGYAASNVSRTESGLTADLTL
AGTACNVYSDDIKDLKLVVEYQTDKRLHVKIFDAAVQVFQVHEEVLPRPNNDQVPASGSN
VALEFDMVESPFSFTVKRKDNGEVLFNTSAVPLIFEKQYVRLRTNLPSDPNIYGLGEHSD
SFRFSKNYQRILYNSESPNLPNNANLYGTHPVYFDHRGDKGTHGVFLLNSSPMNIDLGQN
NGTGTQYLEYNTIGGIIDLYFLGGKSPTEVSQQYADVVGHSQMYPYWAFGFHQCKYGYWD
VNMVAEVVGNYSTAGIPLEVNIDYMNLREDFTTDPERFPLSKMRELVTTLHERDQRYVLI
LDPAIHAVDNYPPHQKGVEQDVFLKAADGSNILGIQWPGVVVWPDWLAPNTPQWWTDEIE
ATFDKDTGIDLDGIWVDMNEASNFCGGIDCKPREQVVNDGTPPKPTNAPRPNTGRPIPGF
PASFQPGSNNSTVKARSVEGRKVHSGKAGAVATRATNDDSTPKGLPDRDLLNPKYRINNH
RGDLASYTIYTNTSNHDGSWQYDTHNYYGHTMSHVTHDSMVKRRPGLRPLVVTRSTFAGT
GRKATHWFGDNYSSWEHYRLSIRQMLAFVSMHNMPMVGSDVCGFNGNADQYMCARWALLG
AFQPFYRNHAELSTIQQEFYQWPIVAEAGKKAINTRYRLIDYIYTALQKQATDGTPMINP
LFFLYPEDDKTFGIQDQWFFGDSLLISPVTEDYSDTVTYYLPKDTFYDYWTHAKVDGQGA
NVTVSNLTYTDIPIHIRGGSIIPHRANSANTTKALRKEAFTFMVAPNAEGKAYGSLYLDD
GESIDQQGTSEVKFSYENGKFGATGSFGYAAQSGESLTVDHVLILGQQEAGKLGTHDAEK
KTIEVKGPWQLNGAWGFEV
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaccagctgctccttgcgattgccgcaggcgcagggctgattgctgcagcccca
acgccccaagaatctcccagcgcactccaggctcgcgatgcggatccgaatagctgccct
ggctacgctgcgtcgaatgtctccaggacggaatcgggtctcaccgcggaccttactcta
gctggtacagcctgcaacgtctacagtgatgacatcaaggacctcaagttggttgtagaa
taccagaccgacaagcgtctccacgtcaagatctttgacgcagctgttcaagtcttccag
gtccatgaagaagtcctgccacgccccaacaacgaccaggttcccgcctctggatccaat
gttgctctcgagttcgatatggtggagagccctttctctttcaccgtcaagcgcaaagat
aatggagaggtcctcttcaacacctctgctgtgccacttatcttcgagaagcagtacgtc
cgcctgcgcaccaatctgcccagcgacccaaacatctacggactcggcgagcatagtgac
tccttccgcttcagcaagaactaccagcgtatcctatacaactctgagtcgcccaatctc
cctaacaatgctaatctctacggcactcaccccgtatacttcgaccatcgcggtgacaag
ggtactcatggcgtcttcctactcaattcgagccccatgaacatcgacctgggccaaaac
aacggcacaggcactcagtatctcgagtacaacaccatcggcggcatcatcgacctttac
ttcctgggcggaaagtcacctactgaggtatcccagcagtatgcagacgtcgttggtcac
tcacaaatgtatccctattgggcttttggctttcaccagtgcaagtacggctattgggac
gtgaatatggttgctgaagtcgttggcaactactcaactgctggcatcccacttgaagtg
aacatcgattacatgaacttgcgcgaagatttcacgactgacccagaacgtttcccactt
tctaaaatgcgtgagcttgtcaccactctccatgagcgtgaccagcggtacgtgcttatc
ctcgatcctgccattcatgctgtcgacaactacccgccccaccagaaaggtgtcgaacag
gatgtattcttgaaggcggccgatggctcaaatattctcggcattcagtggcccggtgtt
gtggtctggcctgactggcttgcgcctaacacgccacagtggtggaccgacgagatcgag
gccacctttgacaaggacactggtatcgacctcgatggcatttgggtcgacatgaatgag
gcgtcaaacttttgcggtggtatcgactgcaaaccccgtgagcaagttgtcaacgacggt
acacccccgaagccgactaatgcgccgcgtcctaataccggccgcccgattcccggcttc
cctgcgtctttccaacctggctccaataattcaactgtcaaggcacgcagtgtcgagggc
cgcaaggtccacagtggcaaggctggtgcggttgcaactcgcgcaaccaatgacgattca
acacccaagggtctgccagaccgcgacctccttaaccccaagtatcgaatcaacaaccac
cgcggcgatcttgcaagttacacaatctacacaaacacctcaaaccacgatggtagctgg
caatacgacacacacaattactacggccacacgatgtctcacgtcactcacgactccatg
gtgaagcgacgtcccggtctccgacccttggtcgtcacccgctccaccttcgctggcacc
ggccgcaaagctacccactggttcggggacaactactcatcctgggagcattaccgtttg
tcgatccgtcaaatgctcgcctttgtcagcatgcacaacatgcctatggtcggttccgac
gtgtgcggcttcaacggcaacgcagatcagtacatgtgcgctcgctgggcgcttttgggc
gccttccagcccttctaccgcaatcacgccgagctctcaaccattcaacaggaattctac
cagtggcccattgtcgccgaggcgggtaagaaggccatcaacacgcgctacaggctcatt
gattacatctatacggcgctacagaagcaggccacggatggcaccccgatgatcaaccct
ctcttcttcctgtaccctgaagatgacaagacgttcggtatccaggaccagtggttcttc
ggtgacagcctgttgatctcgcccgttactgaagactacagtgatactgtgacatactac
ctccccaaggacacgttctacgactactggacgcacgccaaggtcgatggacaaggcgca
aacgtcactgtctctaacctcacatacaccgacatcccgatccacatccgcggtggaagc
atcatcccgcaccgcgccaattctgcgaacaccaccaaggcccttcgcaaggaggccttc
actttcatggttgcgcctaacgcagagggcaaggcttacggctctctgtacctcgatgac
ggcgagagcatcgaccagcagggcaccagtgaggtcaaattctcatacgagaacggcaag
ttcggcgccaccggcagctttgggtacgcggcgcagagcggcgagagccttactgtcgac
catgtgcttatcctgggccagcaggaggccggtaagcttggtactcatgatgcggagaag
aagacgattgaggtcaaggggccgtggcagctgaatggggcttgggggtttgaagtctag

DBGET integrated database retrieval system