KEGG   Parastagonospora nodorum: SNOG_07395Help
Entry
SNOG_07395        CDS       T01161                                 

Gene name
SNOG_07394
Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno00020  Citrate cycle (TCA cycle)
pno00190  Oxidative phosphorylation
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01200  Carbon metabolism
Module
pno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pno_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNOG_07395 (SNOG_07394)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SNOG_07395 (SNOG_07394)
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SNOG_07395 (SNOG_07394)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Epimerase 3Beta_HSD NAD_binding_10 NmrA NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 Thi4 Pyr_redox_2 GIDA FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 5974623
NCBI-ProteinID: XP_001797730
UniProt: Q0ULG9
LinkDB All DBs
Position
Unknown
AA seq 902 aa AA seqDB search
MSELVFVTGGSGHIGSRVIIDALQAGYSICAAVRSHAKKDRILSIPAIKKLNPGKKLEFA
IVPDLLVEGAYDEAIKGATLVIHVASPIPDTHKEGESYQTTLIDPAVKGTLNILEAAKKA
GTIKRVVITSSVVAIISYKDFTSGKTEGMPYNEKSRTPLLQEPYDNTFEAYCASKIAALN
ESEKWLEQEKASISFDIVNIFPGFVIGRDELVTDAQDALRGTNRMVLGPVTGAELSYTPG
ASVHVRDVSLAHVKSLNLKVGGNQGYLLFSGGLKGTRWEESLDFVARYFPEAVKAGTLKN
NGTILSVPQKIDASASEKALGLKYLSHEEQVTDVVGHYLELLAVMANSNFISTNTPSAIV
VGAGGAGLRAAVGLTEAGLKTACVSKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDT
VKGSDWLGDQDAIHYMTREAVPAVVELENYGMPFSRTSDGTIYQRALGGQSLKYGKGGQA
YRTACAADRTGHAMLHTLYGQSLKEGVQFFIEWFALDLMMSEGKCVGVTAMNMEDGTCHR
MFAKNTILATGGEYLKRWVLITEGARGEGGYLINGEGERFMERYAPTAKDLASRDVVSRS
MNLEIIEGRGCGPNKDHIHLQLSHLPKEIIMERLPGISETAGIFAGIDITKEPIPVLPTV
HYCMGGIPTNYHGQVLDVRDGKDHVVDGLYAAGEAACVSVHGANRLGANSLLDIVVFGRA
SAHHISSNHAPSAAHHSAPENIGLDSISEIDSFLNSSGNTPTSSLRDSMQRTMQKTTAVF
RTQDSLSEGHQQLRDIENDFSTDLRVTDRSLIWNSDLIETLELRNLLTNAVQTSKAALTR
TESRGAHARDDYKERDDKEWMKHSLTWQKNVGDKVDWGTRGVVMGTLDEAECQNVPPMKR
SY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagctcgtcttcgtcaccggtggctcaggtcacatcggtagccgagttatcatc
gacgctcttcaagccgggtactctatctgcgccgccgttcgcagtcacgcaaaaaaagac
cgcatcctctcgatccctgccattaagaagctcaaccctggaaagaagctcgaatttgct
attgtcccagatcttctggtcgaaggtgcatacgacgaggccatcaagggagctaccctt
gtgatccatgtggcgtctccgatcccagatactcacaaggagggcgagtcgtaccagacc
actctgattgatccggcggtcaaaggtacactcaacatcctagaggcagctaagaaggcc
ggtacgatcaagcgcgtcgtcatcacctcctccgtcgtcgccatcatatcctacaaggac
tttacttctggcaaaaccgagggcatgccttacaatgaaaagtcccgaacgccgctcctg
caggagccttatgacaatacgttcgaagcgtactgtgccagcaagatcgctgcactcaac
gagagtgagaagtggctggagcaagagaaggcttccatctctttcgacatcgtcaacatc
ttccctggcttcgtcatcggcagagacgaactagtgaccgacgcacaggacgccctgcga
ggcacaaacagaatggtccttgggccagtgaccggtgcagagttgagctacacccctggc
gcctccgtccatgttcgcgatgtctccctggcccacgtcaagagcctgaacctcaaggtc
ggaggcaatcaaggctaccttctcttctctggagggctcaagggtactcgttgggaggag
tctcttgattttgtggcgcgctatttcccggaggcagttaaggctgggactctcaagaac
aacggcacgatcctgtctgtgccgcagaagattgacgcctctgcttcggagaaggctctt
ggtctcaagtacctaagtcatgaagagcaggtcacggacgtggtcggccactaccttgag
cttcttgcagtcatggcgaattccaacttcatctcgactaacacacccagtgcaatcgtc
gtcggcgccggcggtgcaggtctacgcgcagccgtaggcctgacagaagcgggtctcaaa
acagcctgcgtatccaaactttttcctacgcgctcccacaccgtcgcagcccaaggtggc
atcaacgctgccctcggtaacatgactgaagacgattggcgctggcacatgtacgacacc
gtcaaaggctccgactggcttggggaccaggatgccatacactacatgacccgggaagct
gttcccgccgttgtcgagctcgaaaattacggcatgccattctcccgcacgagcgatggc
acgatataccaaagggccttgggcggacagtcgttgaagtatggaaagggaggacaggct
tatcgtacagcgtgtgccgcggatcgaacgggacatgccatgctgcatacgctatatggg
cagagcttgaaagagggagtgcaattcttcatagaatggttcgccctggatttgatgatg
agtgagggcaagtgcgtaggggtcacggcgatgaacatggaggacggaacgtgtcatagg
atgttcgcgaagaatacgattttggcgactggtggtgagtacttgaaacgttgggtactg
atcaccgagggcgcacgtggtgaaggcggctacttgatcaatggcgaaggcgaaagattc
atggagcgatatgcaccaacggcaaaagacctcgcatcacgagacgtcgtaagtagatca
atgaatcttgagatcatcgagggacgaggttgcggaccgaacaaggaccacatccatctg
cagctgtcgcatctacccaaggagatcatcatggaacgtctaccgggtatctccgaaaca
gcaggcatttttgcgggcatcgacatcacgaaggagccaattccggtcttaccaacagtc
cactactgcatgggtggaattccgacaaactaccacggacaagttctagatgtaagagac
ggaaaagatcacgtagtagacggcctgtatgcagcaggcgaggcagcctgcgtaagtgtg
catggcgcaaacagactaggcgccaactctctgcttgacattgtagtatttggtcgagca
tccgcccaccacatctcctccaaccacgccccctcggccgcacaccacagcgcgcccgaa
aacatcggcctcgactccatctccgaaatcgactccttcctcaactcttcaggaaacaca
cctacttcctccctccgcgactccatgcaacgcaccatgcagaaaaccaccgccgtcttc
cgcacgcaggactccctttcagaaggccatcagcagctccgcgacattgaaaatgatttc
agtacagatctgcgcgtcaccgaccgctcgctcatctggaattcggatctcatcgagacc
ctggagttgcgcaatctattgacaaatgcggttcagacgagtaaagccgctctcacgcgg
acggagagtagaggcgcacatgcgcgcgatgattataaagaaagggacgacaaggagtgg
atgaagcatagtctgacgtggcagaagaacgtcggggacaaggtggattggggcacgaga
ggcgtggtgatgggcacgttggatgaggccgagtgtcagaatgtgccgccaatgaagcgg
tcgtattag

DBGET integrated database retrieval system