KEGG   Parastagonospora nodorum: SNOG_09681Help
Entry
SNOG_09681        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pno00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    SNOG_09681
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SNOG_09681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 5976873
NCBI-ProteinID: XP_001799968
UniProt: Q0UEY3
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSNVKGTVTFEQENESSPTKISWDITGNDANAERGMHVHAFGDNTNGCTS
AGPHFNPHNKTHGAPEDEERHVGDLGNFKTDGQGNAQGSVSDKLIKLIGSESVIGRTIVV
HGGTDDLGRGGHEESKKTGNAGPRPACGVIGISN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagccgtcgccgtcctccgtggagactccaacgtcaagggcaccgtcaccttc
gagcaggagaacgagtcctcgcccaccaagatctcatgggacatcaccggcaacgacgcc
aacgctgagcgtggcatgcacgtccacgctttcggtgacaacaccaacggctgcaccagc
gctggacctcacttcaacccccacaacaagacccacggcgcacccgaagacgaggagcgc
cacgtcggtgacttgggtaacttcaagaccgacggccagggcaatgcccagggaagcgtt
tcggacaagctgatcaagttgattggctctgagagcgttattggccgcaccatcgttgtg
cacggtggcactgacgacctcggcaggggcggacacgaggagtccaagaagactggtaac
gctggccctcgtcctgcttgcggtgtcattggtatctccaactag

DBGET integrated database retrieval system