KEGG   Parastagonospora nodorum: SNOG_14343Help
Entry
SNOG_14343        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pno  Parastagonospora nodorum
Pathway
pno00020  Citrate cycle (TCA cycle)
pno00310  Lysine degradation
pno00380  Tryptophan metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01200  Carbon metabolism
Module
pno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNOG_14343
  09105 Amino acid metabolism
   00310 Lysine degradation
    SNOG_14343
   00380 Tryptophan metabolism
    SNOG_14343
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SNOG_14343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OxoGdeHyase_C E1_dh Transket_pyr 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 5981458
NCBI-ProteinID: XP_001804534
UniProt: Q0U1F5
LinkDB All DBs
Position
Unknown
AA seq 998 aa AA seqDB search
MLRNTLRQCARKLQSSPRASLPTLSASPSRTAIQTCRRPLALSQRRTYAIAAEDTNKGVD
ANDSFLQGNTANYVDEMYMLWKRDPESVHVSWQVYFRNMESGDMPVSQAFQPPPTLIAPH
GGIGPDFKPGMGMSSAEGSDIMNHLKVQLLVRAYQARGHHKARIDPLGIRIEAQQFGYSK
PRELELSHYNFTEKDLDQEIELGPGILPRFKTEQRKKMPLRDIIAACERLYCGSYGVEYI
HIPDRQQCDWLRERLEIPQPFKYSVDEKRRILDRLIWGTNFEAFLATKYPNDKRFGLEGG
ESLIPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTAEPNDEG
SGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAILHYNNDEKEARSA
MGILLHGDAAFAGQGIVYETMGFHSLPSYHTGGTIHIIVNNQIGFTTDPRFSRSTPYCSD
IAKAIDAPVFHVNGDDVEALNFVCQLAADFRAEFKKDVVIDMVCYRKSGHNETDQPFFTQ
PLMYKKIAEQKPTLDIYTNKLLEEKTFTKEDIDEHKAWVWGMLDESFNRSKDYQPTAKEW
LTSAWNGFKSPKELATEVLPHLPTAVEASKLEHIAEKIGSAPEDFTVHRNLKRILAGRTK
TVTEGKNIDMATAEALAFGTLCQEGHHVRVSGQDVERGTFSQRHAVLHDQETEKTYTPLQ
NVSEDQATFVISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGERYLQLVNEDPRVFPS
PDKLDRQHQDCNIQIAYCTKPSNYFHLLRRQMNRQFRKPLILFFSKSLLRHPLARSNIEE
FTGESHFQWIIEDPAHSSGEIGSHEEINRVILCTGQVYAALVKERETRGLKDVAITRIEQ
LNPFPWQQLKENLDSYPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNQTEHHNRRHVMYA
GRNPSASVATGLKNSHKKEEKDLLEMAFSVKQDKLKGE
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaacactctgcgccagtgcgcccggaagctccagagctcgccgcgagccagc
ctcccgacgctgtccgcctcgccatcgcggacagccatccagacatgtcgccgcccgctt
gcgctctcgcagcgacggacttatgccattgcggccgaggacaccaacaagggcgttgac
gccaacgactcgttcctgcagggcaacacggccaactatgtcgacgagatgtacatgctg
tggaagcgcgaccccgagagcgtgcacgtctcgtggcaggtctacttccgcaacatggag
tcgggcgacatgcccgtctcccaggccttccagccgccgcccacgctcattgcgccccat
ggcggcatcgggcccgacttcaagcccggcatgggtatgtcctctgccgagggctccgac
atcatgaaccatctgaaggtgcagctgctcgtgcgcgcataccaggcccgcggacaccac
aaggcccgcatcgacccgctgggcatccgcatcgaggcacagcagttcggatacagcaag
ccgcgcgagcttgagctctcccactacaacttcaccgaaaaggacctcgaccaggagatt
gagctgggaccgggtatcctgcctcgcttcaagaccgagcagcgcaagaagatgcccctc
agggacatcatcgcagcctgcgagcgcctctactgcggctcgtacggtgtcgagtacatc
cacatccccgaccgccaacagtgcgactggctgcgtgagcgcttggaaattcctcagcct
ttcaaatactctgttgacgagaagcgccgcatcctcgaccgtctgatctggggcaccaac
tttgaggctttcttggcgaccaagtaccccaacgacaagcgtttcggtctcgagggcgga
gaatctctgattcctggaatgaaggcactcatcgaccgcagcgtcgactatggcgtcaag
gacattgtgattggtatgccgcatcgtggtcgtctcaacgtgctctccaacgtcgtccga
aagcccaacgagtccatcttcagcgagtttgccggaactgccgagcccaacgacgagggc
tccggtgacgtcaaataccatctcggcatgaacttcgagcgccctacgccctctggcaag
cgcgtgcagctctctttggtcgccaacccttcccatctcgaagccgaggacccggtcgtc
ctaggaaagacccgcgccattcttcactacaacaacgatgagaaggaggcccgcagcgcc
atgggaattcttctccacggtgacgcagcctttgctggtcagggtatcgtctacgaaacc
atgggcttccattctctccccagctaccacaccggaggaaccatccacatcatcgtgaac
aaccaaatcggtttcactacggacccccgtttctctcgttccacaccatactgctcggat
attgccaaggccattgatgcccctgtgttccacgtgaacggtgacgacgttgaggctctc
aactttgtttgccagcttgcagctgacttccgcgccgaattcaagaaggatgtggttatc
gatatggtttgctaccgaaagtctggccacaacgagactgaccaacctttcttcactcag
ccactcatgtacaagaagattgcggagcaaaagccaaccttggacatctacaccaacaag
ctgctagaagagaagactttcaccaaggaggacattgatgagcacaaggcatgggtctgg
ggtatgcttgatgagagtttcaaccgcagcaaggactaccaaccgaccgccaaggagtgg
ctcacatctgcatggaatggtttcaagtcgcccaaggagctcgcaactgaggtccttccc
catcttcccaccgcagttgaggcatcaaaactagagcacattgctgaaaagattggaagt
gcgccagaagacttcacagttcaccgcaaccttaagcgtattttggccggacgtactaag
actgtcaccgaaggcaagaacatcgacatggcaaccgccgaggcattggcattcggtact
ctctgccaggagggccatcacgtccgtgtgtctggacaggacgtggagcgtggaaccttc
tcccagcgtcatgctgttcttcacgaccaagaaaccgagaagacatacacgcccttgcaa
aatgtcagcgaggaccaggcgacgtttgtcatctcaaactcgtcgttgagtgaatacgga
gtgctcggtttcgagtacggatactctctgtcatcacccaacgctcttgttatgtgggag
gcccagtttggggagcgctacttgcaacttgtcaatgaagacccccgcgtcttcccatcc
cctgacaagcttgatcgccagcaccaggactgcaacatccagatcgcgtactgcaccaag
ccatccaactacttccacttgctgcgtcgccagatgaaccgtcaattccgcaagcctctt
atcctcttcttctccaagtcactcttgcgacaccctctggcccggtccaacattgaggag
ttcaccggtgaatctcacttccagtggatcattgaggaccctgcccattcgagcggcgag
atcggttcgcacgaggagatcaaccgtgtcattctctgcacaggtcaagtctacgcagca
cttgtcaaggagcgcgagactcgcggactgaaggacgtcgccatcacccgcattgagcaa
ctcaaccccttcccatggcagcaactcaaggagaatctcgactcataccccaacgcgcag
aacatcatctggtgtcaagaagagcctctcaacgccggtgcgtggagcttcacccagccc
agaatcgagactctcttgaaccagaccgagcaccacaacaggaggcacgtcatgtacgcc
ggacgcaaccccagcgcatccgtcgccaccggtctcaagaactcgcacaagaaagaagaa
aaggacctgctcgagatggcgttttccgtcaagcaggacaagttgaagggcgagtag

DBGET integrated database retrieval system