KEGG   Parastagonospora nodorum: SNOG_15278Help
Entry
SNOG_15278        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pno  Parastagonospora nodorum
Pathway
pno00500  Starch and sucrose metabolism
pno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNOG_15278
Enzymes [BR:pno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SNOG_15278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 5982363
NCBI-ProteinID: XP_001805434
UniProt: Q0TYK5
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MLLTSFLSALPAALLLVGAQGSPFPGNDGARQQTALDLFIEAQANVSINGIFANMGPDGS
KAQGAAEGVVIASPSRSDPDYWFTWTRDSALTYKMLIERFVAGDQSLKQKIDDYVSTQAE
LQGVTSPSGSPDNGGLGEPKFNVDRTAFTGPWGRPQRDGPALRATALTIYANYLAANGAS
TQVANIVWPVIAKDLAYVVRYWNQTGFDLWEETNGSSFFTLSASHRALVEGAALATKLGK
TCDGCAEAAPQVICFVQSFWTGSYIDSNINLNDGRTGKDANSLISTIHTFDPNSKCTDAT
FQPCSSRALANHKAVTDSFRSVYAINEGIPQGQAVGVGRYSEDVYFNGNPWYLTTTAAAE
QLYSAAYQWNKLESITVDAVSLPFFNDLLPNVAVGTYAKDSATYTSIIHAVKTYADGYMA
IVMKYTPANGGLSEQFNKANGSPVSAVDLTWSYAAFITATERRNGVVSPSWDESSNNVPP
ETCTGTPACISRTTFNVLATTDLGQEVFVVGQLTELGNWAPVGAQALSASQYTGSNPPWS
GTIDLPAGTIFEYKYIKKTSDGQVFWQAGANSKFTTSTECDSTTTISDGSVTFESWSYPQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcacatcgtttctaagtgcccttccggcagccctactcctggttggcgctcaa
ggttcgcctttccctggaaatgatggtgcgagacagcaaactgcactcgacctgttcatc
gaagctcaagcaaatgtctccatcaatggcatattcgcaaacatgggtcccgatggctcc
aaggcgcagggtgccgcggagggcgttgttatcgccagcccatcacgatctgacccagat
tactggttcacgtggactagggattccgcattgacctataagatgcttatcgaacgtttt
gttgccggagatcaatcactcaagcagaagattgatgattatgtgtctacacaagccgaa
cttcaaggtgtcacgagcccatctggcagccctgacaatggaggacttggtgagcccaag
tttaacgtcgacaggaccgcctttaccggtccttggggtcgtcctcaacgtgatggacca
gctcttcgtgccactgcgctcaccatttatgccaactacctcgctgccaatggcgcatcc
acccaggtagccaatattgtttggcccgtcatcgcaaaagacctcgcatatgttgtacgt
tactggaaccagactggcttcgacttgtgggaggagaccaacggctcatcgttcttcact
ctgtcggcttctcaccgcgctcttgtcgagggcgctgctcttgcgactaaacttggtaag
acatgcgatgggtgtgccgaagctgctccccaggtaatctgtttcgtccagagcttctgg
actggaagttatattgactccaacatcaacctcaacgatggtcgcactggcaaggatgcc
aactctcttatctctacgatccacacttttgaccccaattcgaagtgcaccgatgccact
ttccagccttgctcgtctcgggctcttgccaaccataaggccgttaccgactcttttcgc
tccgtgtacgccatcaacgaaggtattccgcaaggtcaagccgtcggtgtcggaagatat
tctgaggacgtttactttaatggcaacccgtggtacctgactacgactgctgccgcagag
cagctctattccgctgcctatcaatggaacaagctggagtctattaccgtggacgccgta
tccctaccgttcttcaacgacctcttacccaacgtcgcggtcggcacctatgccaaggac
tctgcgacctacacttcgatcatccacgccgtcaaaacatatgctgatggctacatggcg
attgttatgaaatacacacctgccaacggcggtctttcagagcagttcaacaaggcaaat
ggctctcctgtttccgccgttgacctgacctggtcgtacgccgccttcattaccgcgact
gagcgccgcaatggtgtcgtaagcccatcttgggacgaatcatccaacaatgtaccgcca
gaaacctgcaccggaactcctgcctgcatctccaggacaactttcaacgttctcgccact
accgaccttggccaggaggtcttcgttgtcggccaattgacggaacttggcaactgggcc
cctgtaggtgctcaggcactcagcgcgagccagtacaccggcagcaacccgccttggagt
ggaaccatcgatcttccagccggtactatctttgagtacaagtacatcaagaagacttcc
gatggtcaagtgttctggcaagcaggggcaaacagcaagtttaccactagtaccgagtgc
gacagtactacaacgatcagtgacgggagcgtgacattcgaaagctggagttatccacaa
tga

DBGET integrated database retrieval system