KEGG   Parastagonospora nodorum: SNOG_15514Help
Entry
SNOG_15514        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pno  Parastagonospora nodorum
Pathway
pno00500  Starch and sucrose metabolism
pno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNOG_15514
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pno01003]
    SNOG_15514
Enzymes [BR:pno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     SNOG_15514
Glycosyltransferases [BR:pno01003]
 Polysaccharide
  Storage polysaccharide
   SNOG_15514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 5982589
NCBI-ProteinID: XP_001805660
UniProt: Q0TYH4
LinkDB All DBs
Position
Unknown
AA seq 707 aa AA seqDB search
MAETTTRDVNNHVLFEVATEVANRVGGIYSVLKSKAQVTTAEYGASYTLIGPWNRASASV
EVEPIEPKDPALVATIKSMQDRGVQTLYGRWLIDGAPRVLLFDTGTGYRWLDEWKGDLWS
SAGIPSPPGDSETNEAIVFGYLVAWFLGEYVFHEKKRAVIVQFHEWLAGVAVPLCKKRRI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQFFDVDAEAGKRGIYHRYCIERAATHAADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVKKFSATHEFQNLHQQAKVKINDFVRGHFYGHN
DFDPENTLYFFTAGRYEYRNKGVDMFIESLARLNHKMKSENSNMTVVAFIILPAQTQSLS
VASLKGQAVIKSLHDTVNNIAENVAKKLFERSLTWTEGQDLPEDKDLISPADKILLRRRL
FAMKRHDLPPIVTHNMVNDAEDPVLAQLRRCQLFNHPSDRVKVVFHPEFLNSANPVLPLD
YDDFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENASDYGIYI
VDRRMKGVDDSVNQLVDYMFDFTKKSKRQRINQRNRTERLSDLLDWKRMGLEYVKARQLA
LRRAYPGSYEDDEEPDFFGSQEVKISRPLSEPGSPRDRSGMMTPGDFASLQEGREGLSTE
DYIAWKLPEEEEPDDFTFPLTLKTKSKPNSGANTPTIINGTDGLSLN
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggctgagacaacgacgcgggacgtcaacaaccacgtcctctttgaggttgcgactgag
gttgcgaaccgagttggcggtatctactcggtcctcaagtccaaggcccaggtcaccacc
gccgagtatggcgcgtcctacacgctcattgggccgtggaacagggcatctgcctcggtc
gaagttgagccgatagaacccaaagacccggctctcgtagccaccatcaagtcgatgcag
gatcgcggcgtccagaccctgtatggacgatggctgattgacggcgcaccacgtgtgctc
ctcttcgacactggcacgggctacagatggctcgacgagtggaagggtgatctgtggtcg
agtgctggcattccttcgccgccgggcgactcggagaccaacgaggccattgtcttcgga
taccttgttgcatggttccttggcgagtacgtcttccacgagaagaagcgagccgtcatt
gttcagttccacgagtggctcgcaggtgttgcggtcccgctctgcaagaagcgccgcatc
gatgtgaccaccatcttcaccacgcacgctacccttctcggtcgctacctgtgcgcgggc
tctgtcgacttctacaacaacctgcaattcttcgatgtagacgccgaggcaggaaagcgc
ggcatctaccacaggtactgcatcgagcgcgctgccacccacgccgccgatgtcttcacc
accgtgtcgcacatcaccgcatacgagagcgagcatcttctgaagcgaaagccagatggt
gtcctgcccaatggtctgaacgtcaaaaagttctcggccacgcacgagttccagaacttg
caccagcaggcaaaggtcaagatcaatgactttgtacgtggacatttctacggccacaac
gacttcgatccagagaataccctctacttcttcactgccggtcgctatgaatacaggaat
aagggtgtcgacatgttcatcgaatcattggcgcgattgaaccacaagatgaagagcgag
aactccaacatgacagttgtcgccttcatcattcttcccgcacagacacaatccttgtca
gtcgcctccctcaagggacaggctgtcatcaagtctctgcatgacactgtcaacaacatc
gccgagaatgtggccaagaagctatttgaacgctctttgacttggactgaaggccaggat
ctgccagaggacaaggacctcatctcgcccgcagacaagatcctccttcgtcggcgatta
tttgccatgaagcgacacgacctgccgccgattgtcactcacaacatggtcaacgacgct
gaagacccagtactggctcagctccgccgctgccagctgttcaaccacccctcggaccgt
gtcaaggttgttttccaccccgagttcctgaactcggcgaacccagtacttcccctcgac
tacgacgacttcgtccgcggaactcatcttggtgttttctcatcgtactacgagccatgg
ggctacactcccgccgagtgtaccgtcatgggagtaccaagtatcaccaccaacctgtcc
ggtttcggttgctacatggaagagttgattgaaaacgcctccgattacggtatctacatt
gttgaccgaagaatgaagggtgttgacgactctgtaaaccagcttgtggactacatgttc
gacttcaccaagaagagcaagcgccagcgcatcaaccagcggaaccgaacagaacgcctg
agcgatttgcttgactggaagcgcatgggtctcgagtacgtcaaggcgcgacagctcgct
ctccgccgggcctaccccggctcgtacgaggatgatgaggaacccgactttttcggctcg
caagaagtcaagatctcacgaccgctgtctgagcccgggtcgccgcgtgaccgatccggc
atgatgacgcctggtgactttgcctcgttgcaagaaggccgcgagggcctgagcaccgag
gactacattgcgtggaagcttcctgaggaggaagagcccgatgactttacgttcccgctc
actctcaagacgaagagtaagcctaattcaggcgccaacacacccaccatcattaatggt
accgatggtctcagtcttaactaa

DBGET integrated database retrieval system