KEGG   Parastagonospora nodorum: SNOG_15620Help
Entry
SNOG_15620        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno00010  Glycolysis / Gluconeogenesis
pno00051  Fructose and mannose metabolism
pno00052  Galactose metabolism
pno00500  Starch and sucrose metabolism
pno00520  Amino sugar and nucleotide sugar metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01200  Carbon metabolism
Module
pno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNOG_15620
   00051 Fructose and mannose metabolism
    SNOG_15620
   00052 Galactose metabolism
    SNOG_15620
   00500 Starch and sucrose metabolism
    SNOG_15620
   00520 Amino sugar and nucleotide sugar metabolism
    SNOG_15620
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SNOG_15620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pno04131]
    SNOG_15620
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SNOG_15620
Membrane trafficking [BR:pno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    SNOG_15620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CaATP_NAI
Motif
Other DBs
NCBI-GeneID: 5982620
NCBI-ProteinID: XP_001805764
UniProt: Q0TXZ5
LinkDB All DBs
Position
Unknown
AA seq 642 aa AA seqDB search
MDTTSSSSRPTKATVAPKNPSLSWSTRWRDTAWLSLGTHTVVVVLGFVLLAPLLAPHFPD
TLHEIFDRTQHWRTSSPSVTLRNPLVFQEQQICPKPKQHVEFKGTFNTRPERSMALADQA
KQVAAEFDFKQDAVNKAVKEFIREMDEGLQSEGTELSQIPTYVTAVPNGTEKVPLHTRDG
LYMAVDLGGTNFRVCSIQLHGNTTFSLTQSKVAIPRELMVAKTSKELFSFLAKQIELFLK
AHHEEHYVGTLKRRELGGGEIAEEEIFNLGFTFSFPVNQIGINKGMLMRWTKGFDIQDAV
GKDVCALLQTEIDELHLPVKVAALVNDTVGTLMARSYTSPGKTGTLLGAIFGTGTNGAYV
EKLDRVTKLTKDKNAGDYDKSTGEMIVNTEWGSFDNSLRTLPNTPYDVELDKKSVNPGIQ
MFEKRVSGMFLGELLRLALLKLIKDPAVPLFADDNSASNDVHSTTQIHDGSSIWKQWGID
TSFLSVCAGDTSPGYRMLRQTLDKEYEISAVSAEDAEAVREIAVAIGRRAARLSAVAIGA
IVINTGRLSKTAGAATTEQKSGIAPARGEVEVADEDVIDVGVDGSLVEFYPNFEEHIRDA
LRGIPEIGEQGEKRIRIGIAKDGSGVGAALIALVAGKVASPA
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggacacaacgagcagctcttcacgcccaactaaagccaccgttgcgcccaagaacccc
tcactctcttggagcacgcgctggcgtgatactgcctggttgtctctcgggacccacact
gtagtcgtagtccttggattcgtgcttttagctcctctcctcgcaccccacttccctgac
acgctccacgaaatcttcgacaggacccagcattggcgcacctcttcaccaagcgtcacc
ctccggaacccactcgtctttcaggagcagcagatttgtccgaaacccaagcagcacgtc
gaattcaagggcaccttcaacacgcgacccgaacgcagcatggcactcgccgaccaggcc
aagcaggttgctgccgagtttgactttaagcaagatgccgtcaacaaggctgtcaaggag
ttcatcagggagatggatgagggtcttcagtcggaaggcaccgagctgagccagatcccg
acatacgtcacagcggttcccaatggcacagaaaaggtaccattgcacacgagagatggc
ctctacatggctgtcgacctcggcggcaccaacttccgcgtctgctccattcagctacac
ggcaacactaccttctccctcacgcaaagcaaggtcgcaattccccgcgagctcatggtc
gcgaagacttcgaaagagctgttctccttcctcgcgaagcagatcgaattgttcctcaag
gcacatcacgaggagcactatgttggaactctgaagcgccgggagctcggaggaggcgag
attgcggaagaggagatcttcaacttgggattcaccttctcgttccccgtcaaccagatt
ggcataaacaagggcatgttaatgcgctggaccaagggcttcgacatccaggacgcggtc
ggcaaggacgtctgcgctttgctccagacggagattgacgagctacaccttccagttaag
gtcgctgctctggtgaatgacactgtaggaactctcatggcgcgctcttacacctcgccc
ggcaagactggaacactgctcggtgcgatcttcggtaccggaaccaacggtgcctacgtg
gagaagctggacagggttaccaagctcacaaaggacaagaatgcaggagactacgataag
tcaacgggcgagatgattgtcaacaccgaatggggctcgttcgacaactctctgcgcacg
ctaccaaacacgccatacgacgtcgaattggacaagaagtctgtcaaccccggcattcaa
atgttcgagaagcgcgtctcgggaatgttcttgggcgagttactgcgactggctcttctc
aaactgatcaaggacccagcagtccctctgtttgccgacgacaactcagcatccaacgat
gtccacagcaccacacagatccacgacggcagctcgatatggaagcaatggggcatcgac
accagcttcctgagcgtgtgcgccggcgacaccagccctggttaccgcatgcttcgccag
accctcgacaaggagtacgaaatctccgccgtgagcgcagaggacgccgaggcagtgcgc
gaaattgccgtcgccattggccgccgtgcagcgcgtctctctgctgttgccatcggcgcc
atcgtcatcaacactggccgcctcagcaagactgctggcgctgccaccacagagcaaaag
tcaggcatcgcgccggcccgtggcgaagtcgaggttgcagacgaagatgtgattgacgtc
ggtgttgacggatcgcttgtcgagttttaccccaactttgaagagcacatccgcgatgcg
ctgcgtggtattccggaaattggcgagcagggcgagaagaggattaggattggaatcgca
aaggatgggtcgggtgtgggtgcggcgctgattgccctggtggctggcaaggtggcgagt
cctgcgtga

DBGET integrated database retrieval system