KEGG   Parastagonospora nodorum: SNOG_15716Help
Entry
SNOG_15716        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pno  Parastagonospora nodorum
Pathway
pno00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SNOG_15716
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pno02000]
    SNOG_15716
Enzymes [BR:pno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SNOG_15716
Transporters [BR:pno02000]
 Other Transporters
  Pores ion channels [TC:1]
   SNOG_15716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_2 GST_C GST_C_5 GST_C_3 GST_N_4 Glutaredoxin PBECR2
Motif
Other DBs
NCBI-GeneID: 5982785
NCBI-ProteinID: XP_001805855
UniProt: Q0TXF0
LinkDB All DBs
Position
Unknown
AA seq 240 aa AA seqDB search
MVQGHPDADLHPHATGPAAHIVKPLKLYSGWFCPFVQRVWIALEEKKIDYQYIEVNPYNK
PKSLLDLNPRGLVPTLQYQNKPLFESTVLCEFLEDAYPDHTPHLLPKDPYDRARTRIWTD
YVGSRIIPAYHRFLQHQGEEGLKDKQQEFLNHLKEFTKEMDPEGPFFMGQEFSLIDIVIA
PWANRLWVFDHFKGGSGLPEEGKGGEDEEVWKRWRKWLSAVENRKSVKETLSEQRGGEGD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtccaaggccatcccgacgccgatttgcaccctcatgcaacaggcccagcagcgcat
attgtcaagcctctaaaactatactctggctggttttgtccctttgttcaacgagtatgg
atcgccttggaggaaaagaagatcgactaccagtacattgaggtcaatccatacaacaaa
ccaaagtcactactagacctcaatcctcgagggctggtcccaactcttcaataccagaac
aaacccttgttcgaatctactgtgctctgcgagttcctagaagatgcgtatcccgatcac
acaccgcatctgcttcccaaagacccatatgaccgagcgagaacacgtatctggaccgac
tacgtcggcagtcgtatcatcccagcctatcatcgctttctgcagcatcaaggcgaggaa
ggcctgaaggataagcagcaagaattcctcaatcatctcaaggagttcactaaagagatg
gatcctgagggtccgttcttcatgggccaagaatttagcctcatcgacatcgtgatagca
ccatgggcgaacagattgtgggtgttcgatcacttcaaaggcggctcaggattgccggag
gagggtaaaggaggggaggacgaggaggtttggaagaggtggaggaagtggttgagtgca
gtggagaaccgcaaaagtgtgaaagagacgctgagcgagcagcgaggcggcgaaggcgat
tag

DBGET integrated database retrieval system