KEGG   Paenibacillus naphthalenovorans: IJ22_00950Help
Entry
IJ22_00950        CDS       T04167                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00473  D-Alanine metabolism
pnp00550  Peptidoglycan biosynthesis
pnp01100  Metabolic pathways
pnp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IJ22_00950
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IJ22_00950
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    IJ22_00950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pnp01011]
    IJ22_00950
Enzymes [BR:pnp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     IJ22_00950
Peptidoglycan biosynthesis and degradation proteins [BR:pnp01011]
 Precursor biosynthesis
  Amino acid ligase
   IJ22_00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ALS20487
UniProt: A0A0U2VLV7
LinkDB All DBs
Position
99329..100507
Genome map
AA seq 392 aa AA seqDB search
MKVKVGVLFGGMSVEHEVSIISALQAIHALNRDKYEPVPIYIDKQGHWYTGEGLMDIDNY
KQLPELLKKSEQVILHTNQEGKHLLINAASGLFRKKIIDEIHVAFPVTHGTYGEDGSLQG
WLDLNKIPYVGCDVLSSAVGMDKIMMKTIVRGAGLPVIDYVWFYSKRWFDAQQECVELVE
QRLGYPVIVKPANLGSSVGIQKADDREELVEAIESASSYSPRIIVEKMVTNLKEVNCSVI
GDYEHVEASECEEVLKSDEILSYQDKYMNQAAKGMGGTSRIIPAEIGEETTRRVQELAKQ
TFLELGCSGVSRIDFLIDQNTNSVYINEINTIPGSLSFYLWQPKGKDFEQLTDDLIQLAL
KRSRERAQLTFSYDTNLLALQGKGGGKLGTKK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaagtaggggttttgttcggaggcatgtcggtagagcatgaggtatccatc
atatccgctctgcaggctattcacgcgttgaaccgggataaatacgagcccgtaccgatt
tatatcgacaagcaggggcactggtataccggggaagggctgatggatatcgacaattac
aagcagcttccggagctcttgaaaaagagcgagcaagtgattttacatacgaatcaggaa
ggaaagcatcttctgatcaacgccgcatccgggctgttccgcaaaaaaatcatcgatgaa
attcatgtcgcctttccggtcacgcacgggacctatggagaggacgggtccttgcagggc
tggcttgatttgaacaagatcccttatgtcggctgcgatgtgctctcctctgcggtcggt
atggacaaaatcatgatgaaaacgatcgtccgcggcgccggtctgccggtgatcgattac
gtgtggttttacagcaaacgttggtttgacgcgcagcaggagtgtgtggagctggtagag
caaaggctgggttatcccgtgatcgtaaaaccggcaaacctggggtccagtgtcggcata
cagaaagcggacgacagggaagaactggtcgaagcgatagagtcagcgtcatcctattct
cccagaattattgtggagaaaatggtcaccaatttgaaggaagtcaactgttcggtcatc
ggcgactatgagcatgtggaagcttccgagtgtgaagaagtgctgaaatcggacgaaatc
ctgagctaccaggataaatatatgaaccaggccgccaaaggaatgggcggtacgagccgg
attatcccggcggagatcggggaggaaaccacacgccgggtgcaggagctggcgaagcaa
accttcctggagctgggctgcagcggtgtgtcacggatcgattttttgatcgatcagaac
accaacagcgtgtatattaatgaaatcaacaccattccgggctcgctctccttttacctg
tggcagcccaaagggaaggatttcgagcaactgacggacgacctgatccagctcgcgctc
aagcggagccgggaacgggcgcagctcaccttctcttacgacaccaatctgttggcgctg
cagggcaaaggcggcggcaagctgggcactaaaaaatag

DBGET integrated database retrieval system