KEGG   Paenibacillus naphthalenovorans: IJ22_04810Help
Entry
IJ22_04810        CDS       T04167                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00020  Citrate cycle (TCA cycle)
pnp00480  Glutathione metabolism
pnp01100  Metabolic pathways
pnp01110  Biosynthesis of secondary metabolites
pnp01120  Microbial metabolism in diverse environments
pnp01130  Biosynthesis of antibiotics
pnp01200  Carbon metabolism
pnp01210  2-Oxocarboxylic acid metabolism
pnp01230  Biosynthesis of amino acids
Module
pnp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IJ22_04810
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IJ22_04810
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     IJ22_04810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALS20869
UniProt: A0A0U2W035
LinkDB All DBs
Position
488676..489971
Genome map
AA seq 431 aa AA seqDB search
MVQFEQYAQPTEGERITITNGQLNVPNNPIIPFIEGDGTGPDIWAAAQRVLDAAVEKAYK
GEKKIAWYEVFAGEKAFNKFNNWLPADTLTAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCSRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEWASGSEEVKKVIAFLQ
NEMGVKKIRFPETSGIGIKPVSSEGSKRLIRAAIEYAIRHNRKSVTLVHKGNIMKFTEGA
FKNWGYELAEQEFGDKTFTWAQYDKIKEEQGTEAANKAQKDAEAAGKIIIKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
AGLDVVNPGSVILSGVMMLEHLGWLEAAELIYKGMETAINNKTVTYDFARLMEGATEVKC
SAFADEIIKNF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggtacaatttgaacaatatgcgcaaccgacagaaggcgagcgtatcacgatcacgaac
ggtcaattgaacgttccgaacaatccgattattcctttcatcgaaggcgacggtaccggt
ccggacatctgggcggcagcccaacgcgtgttggacgcagcggtagaaaaagcgtacaaa
ggcgagaaaaaaatcgcgtggtatgaagtgtttgccggagagaaagctttcaataaattt
aacaactggctgccggccgatacacttactgctattcgtgaatacattgttgccatcaaa
gggcctttgactactccgatcggcggcggtatccgctccctgaacgtagctcttcgccaa
gagttggatctgtatgtatgttcccgcccggttcgctacttcaacggtgtaccttcccct
gtgaaacgtcctgagctcgtggacatggttattttccgtgagaacacagaggatatctac
gcagggatcgaatgggcttcaggctcggaagaagtgaaaaaagtcattgcgttcctgcaa
aacgaaatgggcgtgaaaaagatccgcttcccggaaacgtccggcatcggtatcaagcct
gtatcttccgaaggttccaagcgtctgattcgtgcggcaatcgaatatgcgatccggcat
aaccgcaagagcgtaaccttagttcacaaaggtaacatcatgaaatttacggagggtgcg
ttcaaaaactggggttatgagcttgctgaacaagagtttggcgacaaaaccttcacatgg
gcgcagtacgataaaattaaagaagagcaaggcacagaagcagcaaacaaagcgcaaaaa
gatgcggaagccgccggtaaaatcatcatcaaagatgcgattgcggatatcgctctgcag
caagtactgactcgtccgactgattttgacgtcatcgccacactgaacctgaacggcgat
tacctgtccgatgcattggcggctcaagtaggcggaatcggtatcgctcctggagcgaac
atcaactatgtgaccggccatgccattttcgaagcaactcacggtacggctcctaaatat
gcaggtctcgatgtagttaatccaggctccgttattctgtccggcgttatgatgcttgag
catctgggttggctggaagcggctgaactgatctacaaaggtatggaaaccgcgatcaat
aataaaacggtaacttacgactttgcacgtttgatggaaggcgcaaccgaagtgaaatgc
tcggcgtttgcggatgagatcatcaaaaacttctaa

DBGET integrated database retrieval system