KEGG   Paenibacillus naphthalenovorans: IJ22_15610Help
Entry
IJ22_15610        CDS       T04167                                 

Definition
(GenBank) glucose-methanol-choline oxidoreductase
  KO
K20927  2-methyl-1,2-propanediol dehydrogenase [EC:1.1.1.400]
Organism
pnp  Paenibacillus naphthalenovorans
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IJ22_15610
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.400  2-methyl-1,2-propanediol dehydrogenase
     IJ22_15610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N Pyr_redox_2 FAD_binding_2 DAO FAD_binding_3 Pyr_redox NAD_binding_8 Lycopene_cycl ApbA Thi4 Fer4_9 Fer4_2 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALS21937
UniProt: A0A0U2UJ66
LinkDB All DBs
Position
1579350..1581014
Genome map
AA seq 554 aa AA seqDB search
MAKHVETNVLVIGAGAAGGAVSKRLSDAGIKVTCLEQGDWVHPLDHPHFHHEWEIERKRG
WDFDPNKRRLPEDYPTTGNATPYVFNAVGGSTRHFAGAWPRFKPVDFRKGTEHGLEGTID
WPISYEELEPFYNINDAELGVARVVGDLGNPKKLKGYGPPIPPGKLGLKMAKAFGKLGWH
WWPADYAILTRHKDGRLPCNACGPCLSGCPRGSIGSTDVTYWPKAIRNGVDLRTNARVER
INVGKDGRATGATYINRITGERHEVRADIVVMCANAVGTPRLLLMSAQNGHPDGLANSNG
LVGTHLMFHSWAFEDFWFDEPIEDFKGPEPASLYSQEFYDTNPNHNFVNGFSLQVGRANG
SAYTAMGTTSGYLAPWGADHRKFFNEHFGRHVLVYVQGEDLPVKTNRVTLDPKVTDSSGL
PAPHLHYKLPENDARLIAFGRQRAREAAEAAGGLTDSSSTGVTGVTKPPPGWHIMGTCRM
GNTPEDSVTNKYNQTWDVPNLFIVDASSLPTSAAVNPTSTLQALAVRCAEYIKRRHSHIL
SQKVTPGNADAPGF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacatgtagaaacgaacgtgctggtaatcggcgcgggcgcggccggtggcgca
gtcagcaaacggctgagcgacgcagggatcaaagtcacgtgcctggagcagggcgattgg
gtacacccgctcgaccacccgcatttccaccacgaatgggagatcgagaggaaacgaggt
tgggatttcgacccgaacaagcgcaggcttccggaggactatccgaccacgggcaacgca
actccgtatgtatttaacgctgttggcggctcaaccagacacttcgcgggcgcttggccg
cgtttcaaaccggttgactttcgtaaggggacggagcacgggctggaaggaacgatcgac
tggccaatcagctacgaggaactggagccgttctacaatatcaatgacgcggagctcggg
gtggcgcgtgtagtcggcgacctggggaatcccaaaaagctgaagggatatggtcctcct
atccccccgggaaagctcggcttgaagatggcaaaggcgtttgggaaactcgggtggcac
tggtggccggcagactacgctatcctgacccggcataaagacggccgtctcccctgcaat
gcgtgcggaccctgcttaagcgggtgcccgcgcggctcgatcggctctactgatgtcact
tactggcccaaggccatccgaaacggtgtcgatctgcgcaccaacgcgcgggttgagcgg
attaacgttggcaaagacgggcgtgctactggcgcgacttacatcaaccggatcaccggc
gagcggcacgaggttcgtgccgacatcgtcgtgatgtgtgcgaatgccgtcggtaccccc
cgcttgctcctgatgtccgcccagaacggacacccggacggtttggcgaacagcaacgga
cttgtaggcacgcacctcatgttccacagctgggctttcgaagatttttggttcgacgag
cccatagaagatttcaagggccccgaaccagcgtccctgtacagtcaggagttctacgac
acgaatccaaatcataactttgtcaacggattctcattgcaagtcgggcgggcaaacggt
tcagcctatacggcgatgggaacgacgagtggttatcttgcgccgtggggggcggatcac
cggaaatttttcaacgaacactttggtcggcatgtgcttgtctatgtgcagggagaggat
ctcccggtaaaaacaaacagggtcacgctggaccccaaagtcaccgattcaagcgggctt
cccgcgccgcacttgcactacaagctgcccgaaaacgacgctcgactcatcgcgttcggc
aggcaaagggcgcgcgaggctgccgaggccgccggcggcctaaccgattcaagcagtacg
ggggttacaggcgttacgaaaccaccgccaggatggcacattatgggcacctgccggatg
ggaaatacgccggaagattcggtaaccaacaaatacaatcagacctgggacgtacctaac
ctgttcatcgtcgacgccagttcgctgccgaccagcgccgccgtcaatccgaccagtacc
ttgcaggcgcttgccgtccgctgcgccgagtacatcaagaggcgtcattcccacatcctg
tcgcagaaggtcacacccggcaatgcggatgcaccgggtttttga

DBGET integrated database retrieval system