KEGG   Paenibacillus naphthalenovorans: IJ22_26250Help
Entry
IJ22_26250        CDS       T04167                                 

Definition
(GenBank) glutamine ABC transporter ATP-binding protein
  KO
K06857  tungstate transport system ATP-binding protein [EC:7.3.2.6]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    IJ22_26250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pnp02000]
    IJ22_26250
Enzymes [BR:pnp01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.6  ABC-type tungstate transporter
     IJ22_26250
Transporters [BR:pnp02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Tungstate transporter
    IJ22_26250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_30 AAA_23 AAA_16 RsgA_GTPase AAA_22 AAA_33 MMR_HSR1 AAA_18 AAA_24
Motif
Other DBs
NCBI-ProteinID: ALS22998
UniProt: A0A0U2VQE2
LinkDB All DBs
Position
2549233..2549973
Genome map
AA seq 246 aa AA seqDB search
MKPIEVEHLTVAAGDRMLLSIPHAAFDEGAVYGIVGPSGAGKSTFLRVLNFLEKPQSGSL
FFSGHRVDLTSLSHSGGLHLQRQMAFVAQKPVMFQTTVFENVALGLSYRGVPRSEKARLV
MEALRLVGLEAAEGRKAASLSGGEAQRIALARALVLQPKLLLLDEPTSNLDPPNVLIIEQ
IITRIRRESPMTILMVTHHLQQARRLSDRCLFLYQGRIVEQNDTQAFFESPQSEALQDFI
SGKMIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccattgaagtcgagcatcttaccgttgctgccggcgatcggatgctgttgtcc
atcccccatgccgcctttgatgaaggcgccgtttatggcattgtaggtcccagcggcgca
ggcaagagcacctttttgcgcgtattgaactttctggagaagcctcaatcgggcagctta
tttttttccgggcaccgggtggatttaacttccctttcccattcgggagggcttcatttg
caaaggcaaatggcgtttgtcgcgcaaaagcccgtcatgtttcagaccacggtttttgag
aatgtagcgttggggttaagctatagaggcgttccccgcagcgagaaagcgcggctggtc
atggaagccttgaggctggtcggtctcgaagccgcggagggacgtaaagcggcatccctg
tcggggggcgaagcccagagaattgcactggcgcgggcgcttgtcctgcagcccaagctc
ctgcttttggatgagcctacctccaatctcgacccgccgaacgtattgatcattgaacag
atcattacccggattcgccgggaaagcccgatgacgatcctcatggttacccaccatttg
cagcaggccagacgcctgtccgaccggtgcctgttcctttatcagggacggatcgtggaa
caaaacgatacgcaagccttttttgaatccccccaaagcgaagcccttcaggattttatc
agcggcaaaatgatctattaa

DBGET integrated database retrieval system