KEGG   Paenibacillus naphthalenovorans: IJ22_29300Help
Entry
IJ22_29300        CDS       T04167                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00010  Glycolysis / Gluconeogenesis
pnp00620  Pyruvate metabolism
pnp01100  Metabolic pathways
pnp01110  Biosynthesis of secondary metabolites
pnp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IJ22_29300
   00620 Pyruvate metabolism
    IJ22_29300
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     IJ22_29300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ALS23303
UniProt: A0A0U2VUU1
LinkDB All DBs
Position
complement(2886457..2887977)
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQAGSKVTFKKRYDNYIGGKWVAPVKGEYFENITPVTGQIFCEVARSTAEDIEL
ALDAAHAAKDAWGRTSAAQRALILQKIADRMEANLEQLAVAETWDNGKPVRETLAADLPL
AIDHFRYFAGCIRAQEGTLGEVDGDTVAYHFHEPLGVVGQIIPWNFPLLMATWKIAPALA
AGNCIVLKPAEQTPASILVLAELIGDLLPPGVLNIVNGFGLEAGKPLASNNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNLFFEDVFAKDDAFLNKAIEGFVLFALNQGEI
CTCPSRALIQESIYEPFIERALKRVAAIKQGNPLDTETMIGAQASSEQVEKILSYISIGK
QEGAECLIGGNRSSLKGDLEGGYYIEPTVFKGHNKMRIFQEEIFGPVVSVTTFKDQEEAL
SIANDTLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKVSGIGRET
HKMMLSHYQQTKNLLVSYSPDALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgcacaaccggggcaagccggctccaaagttacttttaaaaagcgctacgac
aattatatcgggggaaaatgggttgcgcctgtcaaaggggaatattttgagaacatcacg
ccggtaacaggccagattttttgcgaagtggcccgttcgacagcggaagatatcgaattg
gcgctggatgctgcccatgccgccaaggacgcctgggggcgcacatcggcggcccagcgt
gccttgattctgcaaaaaatcgccgaccgcatggaagccaatctggagcagcttgccgta
gccgaaacctgggataacggaaagcccgtccgggaaacgctggctgccgaccttcctttg
gcaatcgaccatttccggtattttgcgggctgcattcgcgcccaggagggaacgctcgga
gaagtggacggcgatacggttgcctatcatttccatgaaccgttaggcgtcgtcgggcaa
atcatcccatggaatttcccgctgttgatggctacatggaagattgcgccggcgctcgct
gcgggcaactgcatcgtgctgaagccagcggagcaaacgccagcttccatcctggtcctg
gcggagctgatcggcgatttgctgcctccaggagtattgaatatcgtcaacggcttcggg
ctggaagcaggcaagcctcttgcttcaaataaccgcatcgccaagatcgcttttacagga
gaaacgacgacaggccgcttaattatgcaatacgcatcacaaaacattattccggttacg
ctggaattgggcggcaagtctcccaatctcttttttgaagacgttttcgccaaagacgac
gcgttcttgaataaggctatcgaagggtttgtgctgttcgctctgaaccaaggcgagatt
tgcacctgcccgtcccgcgccctgattcaggaatcgatttacgaaccattcatcgaacgg
gcattaaagcgcgtggctgcgatcaagcagggcaatccgctcgataccgaaacgatgatc
ggagctcaggcatcttcggaacaggtggagaaaattttgtcctatatcagcattggcaaa
caggaaggtgcggaatgtctgatcggcggaaacagatcgtcgttgaaaggcgacctggaa
ggcgggtattatattgagccgaccgtgttcaaagggcacaacaaaatgcgtattttccaa
gaagagattttcgggccggtcgtttccgtaacgacgttcaaagatcaggaggaagcgtta
tccatcgccaatgacaccctgtacgggctgggggcaggggtatggacccgcgatatcaat
acagcttaccgtttcggaagaggcatacaggccggccgcgtatggaccaactgctaccac
gcttatccggcgcacgcggcattcgggggctacaaggtttccgggattggccgtgaaacg
cacaaaatgatgctttcccattaccagcagacgaaaaacctgcttgtcagctacagccct
gacgctttaggattcttctaa

DBGET integrated database retrieval system