KEGG   Paenibacillus naphthalenovorans: IJ22_30790Help
Entry
IJ22_30790        CDS       T04167                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00020  Citrate cycle (TCA cycle)
pnp00190  Oxidative phosphorylation
pnp00650  Butanoate metabolism
pnp01100  Metabolic pathways
pnp01110  Biosynthesis of secondary metabolites
pnp01120  Microbial metabolism in diverse environments
pnp01130  Biosynthesis of antibiotics
pnp01200  Carbon metabolism
Module
pnp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IJ22_30790
   00650 Butanoate metabolism
    IJ22_30790
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IJ22_30790
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IJ22_30790
    1.3.5.4  fumarate reductase (quinol)
     IJ22_30790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_17 Fer4_9 Fer4_16 Fer4_2 Fer4 Fer4_13 Fer4_4 Fer4_21 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ALS23452
UniProt: A0A0U2UJX2
LinkDB All DBs
Position
complement(3053111..3053878)
Genome map
AA seq 255 aa AA seqDB search
MAEATATASKTIKFIITRQDSPESAPYTEEFEIPYRPNMNVISALMEVQRNPVNAKGEKT
TPVCWESNCLEEVCGACSMVINGKPRQACTALVDKLEQPIRIAPMTTFPVVRDLVINRER
MFSALKRVKAWIPIDGTYDLGPGPRMAEAKRQWAYELSKCMTCGVCLESCPNVNDKTDFI
GPAAISQVRLFNAHPTGEMNAHERLEALMSDGGIEGCGNSQNCVRSCPKGIPLTTSIAAI
NLDTTKHLFKKWLSM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcaaccgcgactgcaagcaaaacgatcaagtttatcataacccgtcaagat
tcaccggaaagtgcgccatacacggaggagtttgaaattccttatcgcccgaacatgaac
gtgatcagcgctttgatggaggtacagcgtaatccggtgaatgccaaaggtgaaaaaacg
acaccggtctgctgggaatcgaactgtttggaggaagtgtgcggagcctgctccatggtt
atcaacggcaaaccgcgtcaggcttgtacagcgctggtagacaagctggaacagccgatc
cgcatcgcaccgatgacgacattcccggttgttcgtgacctggtgatcaatcgcgagcgt
atgttctccgctttgaagagagtgaaagcctggattccgatcgacggcacatacgatttg
ggtcccggtccgcgtatggccgaagctaagcgtcaatgggcttatgagctgtccaaatgc
atgacttgcggtgtatgtctggaatcctgtccgaacgtgaacgacaaaacggactttatc
ggcccggcggccatctcgcaggtgcgtttgtttaacgcgcatccgactggcgagatgaat
gctcacgagcgtctggaagcactcatgtccgacggcggcatcgaaggctgcggaaactcg
cagaactgcgtgcgctcttgtccgaaaggcatcccgctcacgacttcgatcgcagcgatc
aacctcgatacgacgaagcatttgttcaaaaaatggctcagcatgtaa

DBGET integrated database retrieval system