KEGG   Paenibacillus naphthalenovorans: IJ22_30800Help
Entry
IJ22_30800        CDS       T04167                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00020  Citrate cycle (TCA cycle)
pnp00190  Oxidative phosphorylation
pnp00650  Butanoate metabolism
pnp01100  Metabolic pathways
pnp01110  Biosynthesis of secondary metabolites
pnp01120  Microbial metabolism in diverse environments
pnp01130  Biosynthesis of antibiotics
pnp01200  Carbon metabolism
Module
pnp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IJ22_30800
   00650 Butanoate metabolism
    IJ22_30800
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IJ22_30800
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IJ22_30800
    1.3.5.4  fumarate reductase (quinol)
     IJ22_30800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored NAD_binding_8 AlaDh_PNT_C DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ALS23453
UniProt: A0A0U2W7R4
LinkDB All DBs
Position
complement(3053881..3055641)
Genome map
AA seq 586 aa AA seqDB search
MANSKIIVVGGGLAGLMATIKAAEAGVHVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTPEGLLDFRRFGGTK
HHRTAFAGATTGQQLLYALDEQVRRWETAGLVQKYEHWEFLGAVLDDDGVCRGIVGQDLR
SMEVKTFRSDAVILATGGPGIIFGKSTNSVINTGTAASAVYQQGVYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFSVCVDMK
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGDDPRKIPMKIFPAVHYSMGGMWV
DYNQMTNIPGLFAAGECEYQYHGANRLGANSLLSAIYGGMVAGPKAIEYIKGLDKHAEDI
SSSVFDRYTKLHTDKYESILKMDGTENAYVIGKELGEWMTNNMTVVRYNKQLQETIDKIN
ELKQRYRNININDSARFNNPGVAYTRQLWNMLELAHAMTLGALLRDESRGAHYKPEFPER
NDEKFLKTTKAKWTPDGPQIEYEDVDVSLIPPRKRDYTTDKKKGGH
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattcaaaaatcattgtagtcggtggaggtctggcgggcttgatggccaccatc
aaagcggccgaggctggagttcacgtagacttgttctcccttgttcctgtcaagcgctcc
cactccgtatgcgcccagggtggtatcaacggagcggttaatacaaaaggagaaggcgac
tctccgtgggaacattttgacgatacggtatacggaggagacttcctcgcgaaccagccg
cctgttaaagcgatgtgtgaagcggcgcccggcatcatccatttgatggaccggatgggg
gtgatgttcaaccgtacacctgagggtctgctcgatttccggcgtttcgggggaacaaag
caccatcgtacggcatttgctggagcgacaacgggtcaacagctgctgtatgcgctggat
gagcaagtgcgccgttgggaaactgccggtctggttcagaaatacgagcattgggagttc
cttggtgcggtgcttgacgatgacggcgtatgccgaggtattgtcggccaggacctgcgc
agcatggaagtgaaaacattccgttcggatgcggttattttggcgacaggcggtcccggg
atcatcttcggtaaatcgaccaactccgttatcaatacgggtacggcggcgagtgcggtg
taccagcagggcgtttattacgctaacggcgaattcatccagatccacccgacagccatt
ccgggcgacgacaagcttcgtctgatgtccgaatcggcacgcggtgaaggcggacgggta
tggacatataaagacggcaagccttggtacttccttgaggagaaatatcctgcttacggc
aacctggtgccccgtgatatcgctacgcgggaaattttcagcgtgtgcgtggacatgaag
ctgggcatcaacggcgagaacatggtttatcttgacctatcccacaaggatccgaaagag
ctggatgtcaagcttggcgggatcatcgagatctatgagaagtttatgggcgatgacccg
cgcaaaattccgatgaaaattttcccggccgttcactattcgatgggcggtatgtgggta
gattataaccaaatgacaaacattccgggcttgttcgccgcaggcgaatgcgagtaccag
taccacggcgcgaaccgtttgggcgcgaactcactgctgtccgctatctacggcggtatg
gttgccggtccgaaagcgatcgaatatatcaaaggcctggataagcatgcggaagatatt
tcttcctcggtattcgaccgttatacgaagcttcataccgataaatacgaaagcatcctg
aagatggacggcaccgaaaatgcttacgtgattgggaaagagctcggcgaatggatgacc
aataacatgacggtggttcgctacaacaagcagctgcaggaaacgatcgacaagatcaac
gagctgaagcagcgctaccgcaacatcaacatcaacgactccgcccgcttcaacaacccg
ggtgtggcttatacccgtcagctttggaacatgctggaactggcgcatgccatgacgctc
ggcgctttgctgcgtgacgagagccgcggtgcacactacaagccggagttcccggagcgt
aatgacgagaaatttttgaaaacaacgaaggcgaaatggacgccggatggtccgcaaatc
gagtatgaggacgtcgacgtatcactcattccgccccgtaaacgtgactatacgaccgac
aagaagaagggaggtcattaa

DBGET integrated database retrieval system