KEGG   Paenibacillus naphthalenovorans: IJ22_31500Help
Entry
IJ22_31500        CDS       T04167                                 

Definition
(GenBank) cell division protein ZapA
Organism
pnp  Paenibacillus naphthalenovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZapA Mistic
Motif
Other DBs
NCBI-ProteinID: ALS23520
UniProt: A0A0U2M6H3
LinkDB All DBs
Position
complement(3128184..3130322)
Genome map
AA seq 712 aa AA seqDB search
MSGEDKVRMTVDIYGTQYKLISRSSPSYIKSVAALVNDQMHRIAESSPRLDLPKIAVLAA
VNMADEWTRIQKELESTLAKVRQLEKAQDDLAELRGIHAQQQEELSAVNERLAAVTAERD
AQQSAFEQAELESAALRAELNQLEDLRKKLETELAEVRERLDGQLELTGELERQLTEAVG
RTWELEERVHSDAQEAERREKQLRELEQAKQGLERRISELEKEKDGLQGRAASLEAQLVK
QAEAAKQTGQRLSAQEACVRELEQRLQTVQAERDKLVEQLATWERQYAELSDQLDLLQEQ
VAKREQEIELQVTLYNELQQQAAEERVQAQQREAELAEQLEQKRRLQMQLGEQLEKGREL
QQLNDKLQSELEALRREHHEKQEELGLQEELYRELETELEGLRDQSSLREAELQRQLADQ
EKRHAGELAAVRNRAREEAAEQEAALAELERKLSEREAEWKQTADGLEARRAELERQLAQ
QQAYNLQLQESSSQWQQRSESQAAYADELRAKVHEQQEELELQQELYDELQGQYDELQKR
VVSQEAQARQTAERHEAYRAELESKLAERESELAELRREREAAEELSRALVEQCAALEER
QISAQSERDVLQQRLAAQEARIVELEAQAELAKKLGRDLTEQQEELELQIELYNELQEQL
NAQVQQHKALQAEYGQQLEKAEQVYQELETLRSEYEKLQIEYNEWIELVEKE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggtgaagataaagtccggatgaccgtagacatctatggcactcaatataagctg
atttcaaggtcgagtccttcttatataaagagcgttgcggcgctcgtcaatgatcaaatg
catcgaattgccgaaagcagtccccggctggatttgcccaaaatcgccgtgctggcggcg
gtgaacatggcggatgaatggacacgcatacagaaggagctggaaagcacgctcgccaag
gtgcggcagcttgaaaaagcgcaggatgatctggcggagctccgtgggattcatgcgcag
cagcaggaggaactgtctgccgtaaacgagcggttggccgccgtaacggcggagcgggat
gcgcagcaatccgcattcgagcaagccgagctggagtcggctgcacttcgtgcggagctg
aatcagctggaggacctgcggaagaagctggaaacggaactggcggaggtacgggagcgg
ctggacggtcaattggagctgaccggagagctggaacggcagctgacggaagcagtcggg
cgtacgtgggagcttgaagagcgtgttcattcggatgcgcaggaagcggagcgccgcgaa
aagcagctgcgggaactggagcaggcgaagcagggactggagcggcgtatatctgagctg
gagaaagagaaagacggcctgcaaggccgtgcggcttcgctggaagcgcagctcgtcaag
caggcggaggcggcaaagcaaacgggacagcgcctctctgcacaggaggcttgcgtccgt
gagctggagcagcgtttgcagaccgtacaggccgagcgggacaagctggttgagcagctt
gcgacgtgggagcggcagtatgcagagctcagcgatcagctggacctgctccaggagcag
gttgccaagcgggagcaggagattgagctgcaggtaacgctctacaacgaactgcagcag
caggcagcggaagagcgtgtgcaggcgcagcagcgtgaagcggagctggcagagcagttg
gagcaaaagcggcggctgcagatgcagctgggcgaacagctggagaaaggccgggaactg
cagcagcttaatgacaagctgcaatcggagctcgaggcgctgcgtcgcgagcatcatgag
aagcaggaagagctcgggctgcaggaggaactttaccgtgagctggaaacagagcttgaa
ggactgcgggatcaaagcagtttgcgcgaagcagagctgcagcggcagctggcggatcaa
gagaagcggcacgccggggagctggcggccgtgcgcaatcgcgcccgcgaggaagctgcg
gagcaggaagcagctctggcggagctcgagcggaagctgtccgagcgcgaagcggagtgg
aagcagacagccgacgggttggaggcgcgccgggcggagctggaacggcagctcgcgcag
cagcaggcgtacaatctgcagctgcaggaaagcagcagccagtggcagcagcgcagcgag
tcgcaggcggcttatgccgacgagcttcgcgccaaggttcatgagcagcaggaagagctt
gaactgcagcaggaactgtatgacgaactgcagggacagtatgacgagcttcagaagcgc
gtcgtttcccaggaagcgcaggctcggcaaacggcggaaaggcatgaagcgtatagggcg
gaactggaaagcaagctggctgaacgcgaaagcgaattagccgagctgcgccgcgaacgc
gaggcggcagaagagcttagcagggcgctggtagaacagtgcgctgcgctcgaagaacgg
cagatctccgcgcagagcgagcgggatgtgctccagcagcggcttgccgcacaggaagcc
cgcattgttgagctggaggcgcaagccgaactggcaaagaagctggggcgtgatttgacg
gagcagcaggaagagcttgagctgcagatagagctgtataatgagctgcaggaacagttg
aacgcacaggtgcagcagcataaagcgctgcaggccgaatacggacagcagctggagaag
gcggaacaggtatatcaggaactggagaccttgagatccgaatacgaaaagctgcaaatc
gaatataacgagtggattgagctcgtggagaaggaatag

DBGET integrated database retrieval system