KEGG   Paenibacillus naphthalenovorans: IJ22_33860Help
Entry
IJ22_33860        CDS       T04167                                 

Definition
(GenBank) thioredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pnp  Paenibacillus naphthalenovorans
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IJ22_33860
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     IJ22_33860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Thioredoxin_4 Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ALS23747
UniProt: A0A0U2VK73
LinkDB All DBs
Position
complement(3372424..3373953)
Genome map
AA seq 509 aa AA seqDB search
MVLDADIKAQLNQYLQLLEGDVLIKVSAGSDAVSKDMLALVDELATMSSRIKVEQATLPR
TPSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRAPKVEQNVIDQIKNISGEYHF
ESYISLSCHNCPDVVQALNLMSILNPGITHTMIDGAAYKAEAESKNVMAVPTVYLNGEFF
SSGRMTIEDILGKLGSAPDASDFADKAPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVLDTVGIENFISVKYTEGAKLAASLEEHVKEYGIDVMKSQRAKRLEKRDFIEVELE
NGAVLKSKTVILSTGARWRNVGVPGEEEFKNKGVAYCPHCDGPLFAGKHVAVIGGGNSGI
EAAIDLAGIASHVTVLEFMPELKADAVLQDRLYSLPNVTVLKNVQTKEITGTDKVNGISY
IERDTGTVQHIELDGVFVQIGLVPNTDWLGDTVERNRIGEIVVNSHGATNVPGVFAAGDC
TNSPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtactggacgcagacattaaggcacaacttaaccaatatcttcaactcttggaaggc
gacgtgctgatcaaagtcagcgcagggtccgatgcggtgtctaaggacatgctggccttg
gtggatgaactagccaccatgtcttccagaataaaggttgaacaagccacattaccgaga
acaccgagctttagtgtaaatcgtgtgggggaagataccggtgtaacctttgccggtatc
cctctgggacacgaatttacttcattggtgttggctctgctgcaggttagcggtagagct
ccaaaggttgaacagaacgtcattgaccagattaaaaacatcagcggcgaatatcatttt
gaatcctatatcagcctgagctgccacaactgccctgatgttgttcaggcactgaacttg
atgagcatcctcaatccgggcattacgcataccatgattgacggtgcggcgtataaagcg
gaggcagaaagcaaaaacgtcatggctgtgccaacggtttacctcaatggtgaattcttc
agcagcggtcgcatgacaattgaggatattctcggcaaattgggcagtgctccggatgct
tcggattttgccgacaaggctccatacgatgtgcttgttgtcgggggcggcccggctggt
gcaagtgcggcgatttatgcggcacgcaaaggcattcgcacaggcattgttgctgaacgt
tttggtggtcaggttttggataccgtaggtatagagaactttatcagcgttaaatatacc
gaaggtgctaagctcgcagcgagtcttgaagagcacgtgaaagagtacggtatcgatgtg
atgaaatcacagcgcgccaagcgtttggagaaaagggatttcatcgaagtcgagctcgaa
aacggcgctgttctaaagagcaagaccgtaattctttcaacgggtgcccgttggcgcaat
gtaggcgtacccggagaagaggagttcaagaacaaaggtgtagcttactgtcctcattgt
gacggtcctttgtttgcaggaaaacacgtagcggtgatcggcggcggtaattccggtatt
gaggcggccattgatctcgcaggcattgcgagccatgtcaccgttctggagtttatgccg
gagctgaaagctgatgctgtactgcaagatcgtctttacagtctgcctaacgtcactgtt
ctgaagaacgttcaaaccaaagaaattaccggtaccgacaaggtgaacggtatatcctat
attgagcgcgatacaggaacggttcagcatattgaactggatggcgtgtttgttcagatc
ggtcttgtacccaataccgattggttaggcgatacggtcgaacgcaatcgcatcggggag
atcgttgtgaatagccacggcgctacgaacgtacctggcgtgtttgctgcaggcgactgc
acgaacagtccgtataagcagatcattatttcaatgggatcgggtgctaatgcagccctg
ggcgcatttgattatctaatccgaaattaa

DBGET integrated database retrieval system